(data stored in ACNUC30630 zone)

EMBL: CP001096.PE289

CP001096.PE289       Location/Qualifiers
FT   CDS_pept        312242..312805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98851"
FT                   /db_xref="GOA:B3Q8A2"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A2"
FT                   /protein_id="ACE98851.1"
FT                   /translation="MSSAKPAELKKFVVRLALAVALAAPVAGCFQPMYADRGDGSPTLR
FT                   DKLNAIEVPPLDIPNGSRNSRLGVELRNKLMFKLYGSATGAPPLYTLKISISTSRSSLI
FT                   VDPSTQLPTIENYAIDASYQLKDIATGKTVVSGNTFSRVEYDVPGQSQRFARTRAGRDA
FT                   EDRAVQEIAENINTRLASFFYAGM"
     atgtcgtcgg ctaagcccgc ggagctcaag aagttcgtcg tccggttggc gctggcggtt        60
     gcgctggccg ccccggtcgc cggctgcttc caaccgatgt acgccgatcg cggcgacggt       120
     tcgccgacgc tgcgcgataa gctgaacgcc atcgaagtcc cgccactgga tattccgaac       180
     gggtcgcgca attcccgcct cggcgtcgag ctgcgcaaca agctgatgtt caagctgtac       240
     ggcagcgcca ccggcgcgcc accgctgtac acgctgaaga tctcgatctc gacctcgcgg       300
     tcgtcgctga tcgtcgatcc cagcacgcag ctgccgacga tcgaaaacta cgcgatcgac       360
     gccagctatc agcttaagga catcgccacc ggcaagaccg tggtgagcgg caacactttc       420
     tcgcgcgtcg aatacgacgt gcccggccaa tcgcagcgct tcgcccgcac ccgcgccggc       480
     cgcgatgcgg aagaccgcgc cgtgcaggag atcgccgaga acatcaacac tcggctcgcc       540
     tcgttcttct acgccgggat gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page