(data stored in ACNUC30630 zone)

EMBL: CP001096.PE291

CP001096.PE291       Location/Qualifiers
FT   CDS_pept        complement(314155..315045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0293"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: nwi:Nwi_0094 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98853"
FT                   /db_xref="GOA:B3Q8A4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8A4"
FT                   /protein_id="ACE98853.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEATQVERPRAQRKVPIEFIKANP
FT                   RNPRRTFTDAELGELSDSIKQHGVIQPIVVRPVKGSADRYEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDALALEIAIVENVQREDLNPLEEALGYQALAAEFNRSQEEIAKIVGKSRS
FT                   HVANMMRLIKLPDDVKSLIASGELTAGHARALIGLPDPSTIAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRATASAKSVKDADTLALEKRLSDALGMKVTIDDHEGTGAVQIRYAD
FT                   LDQLDDIIRRLEVGG"
     atggccgatg agcaccgttc gcgactgggg cgtggcttgg cgagtctgat cggcgatgtc        60
     ggcggcgagg ccacgcaggt cgagcggccg cgggcacagc gcaaggtgcc gatcgaattc       120
     atcaaggcca atccgcgcaa cccgcgtcgc accttcaccg atgccgagct cggtgaattg       180
     tccgactcga tcaagcagca cggcgtgatc cagccgatcg tggttcgtcc ggtgaagggc       240
     tccgccgatc gctatgagat catcgcgggc gagcggcgct ggcgcgcagc gcagcgcgcc       300
     ggtctccacg aagtgccgat cgttccggtc gatgtgtcgg acgcgctcgc gctggaaatc       360
     gccatcgtcg aaaacgttca gcgcgaagat ctcaatccgc tcgaagaggc gctgggctat       420
     caggctctgg ccgccgagtt caatcgcagc caggaagaga tcgccaagat cgtcggcaag       480
     agccgtagcc acgtcgccaa tatgatgcgg ctgatcaagc tgcccgacga cgtcaagtcg       540
     ttgatcgcat ccggcgaatt gaccgcgggt cacgcccgcg cgctgatcgg tctgcccgat       600
     ccatcgacga tcgccaagcg gatcgtcgct gaagggctca atgtccggca aaccgaagcg       660
     ctcgcgcatg aagaaggcgt gccggagcgc aagccgcaga agccccgcgc cacggcgagc       720
     gccaagtcgg taaaggacgc cgatacgctg gcgctcgaaa aacgcctcag cgatgcgctc       780
     ggcatgaagg tgacgatcga cgatcacgaa ggcaccggcg cggtccagat tcgctacgcc       840
     gatctcgatc agctcgacga catcatccgc cggctcgagg tgggcggtta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page