(data stored in ACNUC30630 zone)

EMBL: CP001096.PE293

CP001096.PE293       Location/Qualifiers
FT   CDS_pept        complement(316100..316771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0295"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: bra:BRADO0194 glucose
FT                   inhibited division protein B; methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98855"
FT                   /db_xref="GOA:B3Q8A6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8A6"
FT                   /protein_id="ACE98855.1"
FT                   /translation="MQRAARPLVSVSDLDADKAAALKLIPIPSALEARLDAYVALLQQW
FT                   QAKTNLVAPSTLPQLWTRHVADSLQLVSLMPHARRWLDFGSGGGFPGVVLACAMADVGG
FT                   HVTLVERIAKKAAFLREALRVAGAPGTVVLADIGDNVDRFPQALDCITARAVAPLHQLI
FT                   GFAEPLMTPGITKALFLKGQDVDAELTESTKYWKFQPKLHASLTGGQGWIVEIDHIERR
FT                   T"
     atgcagcgcg ctgccagacc tctcgtttcc gtctcagacc tcgacgctga caaagcggcg        60
     gcgctgaagc tcatcccaat cccgtcggcg ctcgaagccc gcctcgatgc ctatgtcgcg       120
     ctgctgcagc aatggcaggc taagactaac ctggtcgctc cctcgaccct gccgcagctt       180
     tggacccggc acgtcgcgga ttcgctgcag ctggtcagtc tgatgccgca tgcccggcga       240
     tggctcgact tcggatcggg aggcgggttt cccggtgtgg tgctggcctg cgcgatggcg       300
     gacgtcggtg gacacgtcac gttggtggag aggattgcca agaaggccgc gttcctgcgc       360
     gaggcgctcc gcgtcgcggg cgcaccgggc acagtcgttc tcgcggacat cggggataac       420
     gtggatagat tcccacaagc cctcgattgc atcaccgccc gtgcggtcgc tccgctacac       480
     cagctcatcg gttttgccga accgctgatg acccccggaa tcacaaaggc gttgttcctg       540
     aaaggtcaag atgtagatgc agaattgacg gaatctacta aatattggaa attccagccc       600
     aagctgcatg ccagcttgac cggtggccag ggctggatcg tcgaaatcga ccacatcgaa       660
     cgacgcacat aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page