(data stored in ACNUC30630 zone)

EMBL: CP001096.PE307

CP001096.PE307       Location/Qualifiers
FT   CDS_pept        complement(331150..331761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98869"
FT                   /db_xref="GOA:B3Q8C0"
FT                   /db_xref="InterPro:IPR019691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q8C0"
FT                   /protein_id="ACE98869.1"
FT                   /translation="MSMAGAERPVSSAAGLPVRWALAVVLALLAIQATALFAMGRVPIC
FT                   TCGTVKLWHGVVQSSENSQHLTDWYTFSHIIHGFLFYAGTWLLLRRWSWTARLIVATLI
FT                   EGGWELTENSSFIIERYRAGTISLDYYGDSIVNSVADTLAMISGFLLARWLPIAATVAI
FT                   AVLFEVLVGLHIRDNLTLNVIMLIHPFDAIRQWQAGPPII"
     atgagcatgg ccggggccga acggccggtg tcgtccgcgg ccggtctgcc ggtccgctgg        60
     gcactggccg tcgttctggc cctgctggcg atccaggcga ccgcgctgtt tgcgatggga       120
     cgggtgccga tctgcacctg cggcaccgtc aagctgtggc acggcgtggt gcagagttcg       180
     gagaactcgc agcacctcac cgactggtac acgttctcgc acatcatcca cggcttcctg       240
     ttctatgccg gaacgtggct gctattgcgg cgctggtcgt ggaccgcgcg gctgatcgtg       300
     gcgacgctga tcgaaggcgg ctgggagctg accgagaatt cgagcttcat catcgagcgc       360
     taccgcgccg gcacgatctc gctcgattac tacggtgaca gcatcgtcaa ttcggtcgcc       420
     gatacgctgg cgatgatctc tggcttcctg ctcgcgcgct ggctgccgat cgccgcgacc       480
     gttgcgatcg cggtgctgtt cgaagtgctg gtcggcttgc acatccgcga caatctgacc       540
     ctcaacgtga tcatgctgat tcatccgttc gatgccatcc ggcaatggca ggcgggacct       600
     ccgatcatct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page