(data stored in ACNUC30630 zone)

EMBL: CP001096.PE310

CP001096.PE310       Location/Qualifiers
FT   CDS_pept        333136..333657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98872"
FT                   /db_xref="GOA:B3Q8C3"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q8C3"
FT                   /protein_id="ACE98872.1"
FT                   /translation="MPVFTVHAPRADDDEPQRAAPEQFRFVRDGFYFWAFVFGPFWLLY
FT                   RRLWLATLGYLVVIAASAVALTALHAGSGTRFVVALLLASLLGLEAGSVWRWTLARRGW
FT                   QSVGVAVGEDREIAERRFFDRWVAGQPQPISFTLPVDRGAPPPARTIPLPASSIHGDIF
FT                   GSFPNPGGSR"
     atgccggtgt tcactgttca tgccccgcgg gcggacgacg acgagccgca gcgcgctgcg        60
     cctgagcagt ttcgcttcgt ccgcgatggg ttttacttct gggccttcgt gttcgggccg       120
     ttctggctgt tgtaccgccg gctgtggctg gcgacgctcg gctatctggt ggtgatcgcc       180
     gcctccgcgg tggcgctgac cgcgctgcat gccggaagcg gcacccgttt cgtggttgcg       240
     ctgctgctcg ccagcctgct cgggctcgaa gccggcagcg tatggcgctg gaccctggcc       300
     cggcgcggct ggcagtcggt cggcgtagcg gtcggcgagg accgcgagat cgccgaacgg       360
     cggttcttcg atcgctgggt tgccggccag ccgcagccga tcagcttcac cctcccggtc       420
     gaccgcggtg cgccgccgcc ggcccgcact attccgctgc cggcgtcgtc gatccatggc       480
     gacatcttcg gctcgttccc gaaccccgga ggctcgcgat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page