(data stored in ACNUC30630 zone)

EMBL: CP001096.PE312

CP001096.PE312       Location/Qualifiers
FT   CDS_pept        334301..335038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0314"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: bbt:BBta_0145
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98874"
FT                   /db_xref="GOA:B3Q950"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q950"
FT                   /protein_id="ACE98874.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAQSFAAQGFQ
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKVVSMPVQLGGGIRDLKTIEAWLSKGIARVIIGT
FT                   AAVRDPALVKEAAKAFPGRVAVGLDARDGNVAVEGWAESSQVTALDIAQRFEDAGVAAI
FT                   IFTDIARDGLLKGINWDATIALAEAISIPVIASGGLASIEDVRTLLSPRAKKLEGAIAG
FT                   RALYDGRLDPTEALALIGAAKAA"
     gtgattctct tccccgcgat cgatctcaag aacggccagt gcgtgcggct cgaacagggc        60
     gacatggcgc gcgccacggt gttcaacctc gatcccgccg cgcaggcgca gagctttgcg       120
     gcgcagggct tccagtacct gcacgtcgtc gatctcgacg gcgccttcgc cggcaagccg       180
     atgaacgccc aggcggtcga ggcgatgctg aaggtggtgt cgatgccggt gcagctcggc       240
     ggcggcatcc gcgacctcaa gacgatcgaa gcctggctgt ccaagggcat cgccagggtc       300
     atcatcggca ccgccgcggt gcgagatccg gcgctggtga aggaagccgc caaggccttc       360
     cctggccgcg tcgccgtcgg cctcgacgcc cgcgacggca acgtcgcggt cgagggctgg       420
     gccgagagct cgcaggtcac cgcgctcgac attgcgcagc ggttcgaaga cgccggtgta       480
     gccgcgatca tcttcaccga catcgcccgt gacgggctgc tcaagggcat caactgggac       540
     gcgaccatcg cgctggccga ggcgatttcg attccggtga tcgcctccgg cggcctcgcc       600
     tcgatcgaag acgtcaggac gctgctcagc ccgcgcgcca aaaagctcga aggcgcgatc       660
     gccgggcggg cgctgtacga cggccggctc gatcccactg aggcgctggc gctgatcggc       720
     gccgccaagg cggcctaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page