(data stored in ACNUC30630 zone)

EMBL: CP001096.PE318

CP001096.PE318       Location/Qualifiers
FT   CDS_pept        complement(340519..342057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0320"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: bja:bll0661 hypothetical protein; TIGRFAM: Mg
FT                   chelatase, subunit ChlI; PFAM: magnesium chelatase ChlI
FT                   subunit; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98880"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q956"
FT                   /protein_id="ACE98880.1"
FT                   /translation="MVQHVSTVAFEGIEARSVDVQVQVSPGLPAFAMVGLADKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADLPKEGSHYDLPIALGLMAAIGAIPADALEGFT
FT                   VLGELGLDGSIAPVAGVLPAAIAANAREHGLICPAACGSEAAWASPDIQIIAASSLIQI
FT                   ANHFKGSQLLGRPQPRVREAEASMLDLRDIKGQESAKRALEIAAAGGHHLLMIGAPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIRDGALTARRPFRAPHHSASMAALTGG
FT                   GIKARPGEISLAHQGVLFLDELPEFDPRVLDSLRAPLETGEVAVSRANHRVTYPARVML
FT                   VAAMNPCRCGHAFEPGFACKRGRVDRCTSDYQSRISGPLMDRIDLRIEVPAVSAADLIL
FT                   PPPAEGSAEVAARVAAARDVQRTRYASIGLPQIRTNAEAPAAVLETTAQPDSAGLKLLH
FT                   DAAETMRLSARGYHRVLRVARTLADLDGCDRIGRVHLAEALSYRALADDQRRAA"
     atggtccagc acgtatccac cgtggcgttc gaaggcatcg aggcgcgcag cgtcgatgtc        60
     caggtccagg tgtcgcccgg actcccggcc ttcgccatgg tcgggttggc cgacaaggct       120
     gtgtcggaag cgcgcgaacg ggtgcgatcg gcgctgatcg catcgggcct ggcgctgccg       180
     gcacggcgga tcaccgtcaa tctcgctccc gccgatctgc ccaaggaagg cagccattac       240
     gacctgccga tcgcgctcgg cctgatggcg gcgatcggcg ccatcccggc cgacgcactc       300
     gaaggcttca cggtgctcgg cgagctcggt ctcgacggtt cgatcgctcc ggtggccggc       360
     gtcttgccgg ccgcgatcgc cgccaatgcg cgcgagcacg gcctgatctg cccggcggcc       420
     tgcggctccg aagcagcctg ggcgagcccc gacatccaga tcattgcggc cagctcgctg       480
     atccagatcg ccaatcactt caaaggctcg caattgcttg ggcggccgca gccgcgggtc       540
     cgggaagccg aagcctcgat gctcgacctg cgcgacatca agggccagga gagcgccaag       600
     cgcgcgctcg aaatcgccgc agccggcggg catcacctct tgatgatcgg agcgccgggt       660
     gccggcaagt cgatgctggc ggcgcggctg ccctcgatcc tgccgccatt gtcaccggcc       720
     gagctgttgg aagtgtcgat gatcgcctcg gtcgccggcg aaatccgcga tggcgcgctg       780
     acggcccgcc ggccgttccg cgcgccgcac cactccgcca gcatggcagc gctgaccggc       840
     ggcggcatca aggcgcggcc cggcgagatt tcgctggcgc atcaaggcgt gctgtttctc       900
     gacgagctgc cggagttcga tccgcgcgtg ctggattcgc tgcgggcacc gctggaaacc       960
     ggcgaagtcg ccgtgtcgcg cgccaatcac cgcgtcacct atccggcgcg ggtgatgctg      1020
     gtggcggcga tgaatccatg ccgctgcggc cacgcattcg aaccgggctt tgcgtgcaag      1080
     cgcggccggg tcgatcgctg cacgtcggac tatcaatccc gcatctccgg tccgctgatg      1140
     gaccgcatcg atctgcgcat cgaagtgccg gcggtcagcg ccgccgacct gatcctgccg      1200
     ccaccagccg aaggctcggc cgaagtcgca gcgcgcgtcg ctgcggcgcg cgacgtacag      1260
     cggacacgct acgcgtcgat cgggctgccg cagatccgta ccaatgcgga agcgccggcg      1320
     gcggtgctgg agaccacggc acagccggat tcggccgggc tgaaactgct gcacgacgcc      1380
     gctgagacca tgcggctgtc ggcgcgcggt tatcatcgcg tgctgcgggt tgcccgcacg      1440
     ctggccgacc tcgacggctg cgaccgcatc ggccgcgtcc atctggccga agcattgtcg      1500
     tatcgcgcgc tggccgacga tcagcgccgc gcggcttga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page