(data stored in ACNUC30630 zone)

EMBL: CP001096.PE319

CP001096.PE319       Location/Qualifiers
FT   CDS_pept        complement(342157..342381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98881"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q957"
FT                   /protein_id="ACE98881.1"
FT                   /translation="MNASSKPRGARPITLNPPLKQHAVCIDALASTINRAIEQAEELGI
FT                   SSAVQLLMMARLEVDLTEIALESRTKNSA"
     atgaatgcct cgtccaagcc ccgcggcgcc cggccgatca cgctgaaccc gccgttgaaa        60
     cagcatgcgg tctgcatcga tgcgctggcc tcgaccatca accgcgccat cgagcaggcc       120
     gaagagctcg gcatctcgtc ggcagtccaa ctgctgatga tggcgcggct cgaggtcgac       180
     ctgacggaaa tcgcgctgga gagccgcacc aaaaacagtg cctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page