(data stored in ACNUC30630 zone)

EMBL: CP001096.PE321

CP001096.PE321       Location/Qualifiers
FT   CDS_pept        complement(343120..343851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0323"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bbt:BBta_7112 putative N-acyl
FT                   homoserine lactone transcriptional regulator, LuxR-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98883"
FT                   /db_xref="GOA:B3Q959"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q959"
FT                   /protein_id="ACE98883.1"
FT                   /translation="MIVGEDQLWGRRALEFVDSVERLEAPALISRFESLIASCGFTAYI
FT                   MAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDPVPRHGATTVYPFVWSDAPYDR
FT                   DRDPAAHRVMTRAAEFGLVEGYCIPLHYDDGSAAISMAGKDPDLSPAARGAMQLVSIYA
FT                   HSRLRALSRPKPIRRNRLTPRECEILQWAAQGKTAWEISVILCITERTVKFHLIEAARK
FT                   LDAANRTAAVAKALTLGLIRL"
     atgatcgtcg gcgaagatca gctttgggga cggcgtgcgc tggaattcgt cgattccgtc        60
     gaacggctcg aggcgccggc gctgatcagc cggttcgaat cgctgatcgc gagctgcgga       120
     tttaccgcct acatcatggc cggcctgccg tcgcgcaatg ccggactacc ggagctgacg       180
     ctggccaatg gctggccgcg cgactggttc gatctgtatg tcagcgaaaa cttcagcgcg       240
     gtcgatccgg tgccgcgcca cggcgctacc acggtttatc ctttcgtatg gtccgatgca       300
     ccctacgacc gcgaccgtga cccggccgcc caccgggtca tgacccgggc ggccgaattt       360
     ggactggtcg aaggctactg cattccgctg cactacgacg acggtagcgc cgcgatcagc       420
     atggccggca aggatccgga cctcagcccg gccgcgcgcg gcgcgatgca gctggtcagc       480
     atctacgcgc atagtcgcct gcgcgcgctc agccggccaa agccgatccg gcgcaaccgg       540
     ctcacgccgc gcgagtgcga gatcctgcaa tgggcagcgc agggcaagac cgcctgggag       600
     atctcggtga tcctctgcat caccgagcgc acggtgaaat tccatctgat cgaagccgcc       660
     cgtaagctcg acgccgccaa ccgcaccgcg gcggttgcca aggcattgac gctcggattg       720
     atccgtttgt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page