(data stored in ACNUC30630 zone)

EMBL: CP001096.PE329

CP001096.PE329       Location/Qualifiers
FT   CDS_pept        complement(349787..350419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0331"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   bbt:BBta_0185 putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98891"
FT                   /db_xref="GOA:B3Q967"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q967"
FT                   /protein_id="ACE98891.1"
FT                   /translation="MHRRITGKLVIATHNPGKLAEMRELLAPYGIEAISAGELGLAEPD
FT                   ETGGSFQANARIKAEAAAKAAQLPAFADDSGLTVDALDGAPGIYSARWAGDAKDFAGAM
FT                   ARIERLLQERGATAPERRTAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGTAGFGYD
FT                   PVFLPEGHSRTFGEMTSVEKHGLPPLGLGLSHRAKAFVKLAEICLAG"
     atgcaccgtc gaatcaccgg caagctcgtg atcgccaccc acaatcccgg caagctggcc        60
     gagatgcgcg agctgttggc tccttacggc atcgaggcga tctccgccgg cgagctcggc       120
     cttgccgaac cggacgagac cggcggcagc ttccaggcga atgcccggat caaggccgag       180
     gccgccgcca aggccgcgca actacctgcg tttgctgatg attccggcct tacggtggat       240
     gcgctcgacg gcgctcccgg gatctattcg gcccgctggg ccggggatgc gaaggatttt       300
     gccggcgcga tggcgcggat cgagcgactg ctgcaggagc gcggcgcgac cgcgccggag       360
     cgacgcaccg cgcatttcgt ctcggcactg tgcgtcgcct ggccggacgg gcacatcgaa       420
     gaagtcgaag cccgtgccga cggcaccttg gtgtggccgc cgcgcggcac cgccggcttc       480
     ggctacgacc cggtgttcct gcccgagggc cacagccgca ccttcggcga gatgaccagc       540
     gtcgaaaaac acggcctgcc gccgctcggc ctcggcctgt cgcatcgcgc caaggcgttc       600
     gtcaaactgg cggagatctg ccttgcaggc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page