(data stored in ACNUC30630 zone)

EMBL: CP001096.PE330

CP001096.PE330       Location/Qualifiers
FT   CDS_pept        complement(350471..351184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0332"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: nha:Nham_0151 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98892"
FT                   /db_xref="GOA:B3Q968"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q968"
FT                   /protein_id="ACE98892.1"
FT                   /translation="MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEE
FT                   RLPPWLKGQGRGWVTAEYGMLPRATLERTRREASAGKQNGRTVEIQRLIGRSLRTIVDL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCLNWMKARNMIKGQVLRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRLVEVQGTAERTPFSQDEFLQLMALAQ
FT                   KGVARLVDLQKMAVG"
     atgcggccga gccgccgtgc gcccgacgaa ttgcgcgccg tgtcgctgga acgcggcgtg        60
     gtcaaatatg ccgagggctc ctgcctggtg aagttcggcg acacccatgt gctggtgacc       120
     gccaccctgg aagaacggct gccgccgtgg ctgaagggcc agggccgcgg ctgggtgacg       180
     gccgaatacg gcatgctgcc gcgcgccacc cttgagcgca cccgccgcga agcctccgcc       240
     ggcaagcaga acggccgcac cgtcgagatt cagcgcctca tcggccgctc gctgcgcacc       300
     atcgtcgatc tcgaagcgct cggcgagcgc cagatcacgg tggactgcga cgtgctgcag       360
     gccgatggcg gcacccggac ggcctcgatc accggcgcct gggtcgcgct tgcggactgc       420
     ctgaactgga tgaaggcccg caacatgatc aagggccagg tgcttcgcga caacgtcgcg       480
     gcgatctcct gcgggatcta caacggtacg ccggtgctcg atctcgacta cgccgaggat       540
     tccgaggctg agaccgacgc caacttcgtg atgaccggcg acggccgtct ggtcgaagtg       600
     cagggcaccg cggaacgcac tccgttctcg caggacgagt tcctccagct gatggcgctg       660
     gcgcagaagg gcgtcgcccg gctggtggac ctgcagaaaa tggcggttgg gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page