(data stored in ACNUC30630 zone)

EMBL: CP001096.PE331

CP001096.PE331       Location/Qualifiers
FT   CDS_pept        351340..352428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0333"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: nwi:Nwi_0194 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98893"
FT                   /db_xref="GOA:B3Q969"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q969"
FT                   /protein_id="ACE98893.1"
FT                   /translation="MAQHDPIGLIAPNAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLISVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQIGDLTEP
FT                   ERQSIQAQLSSVGRAHTVEAALGEALTRLSGLTRAAAVVLTAKANVRLKHIEFVRLEPE
FT                   RALVILVAEDGQVENRVLTLPPGVPSSALIEAANYLNARIRGRTLAEARLELESLMVQN
FT                   KAELDQLTQKVIAAGIASWSGGDGEDRQLIVRGHANLLEDLHALDDLERVRLLFDDLET
FT                   KRGVIDLLGRAESADGVRIFIGSENKLFSLSGSSTIIAPYSDGAGHIVGVLGVIGPTRL
FT                   NYARVIPMVDYTARIVSRMLGG"
     ttggctcagc acgacccgat cggcctgatc gcgcccaatg ccggccttgc ccagctcaac        60
     gagcgttcgc gggagatttt tcgtcagatc gtcgaaagct accttgcgac cggtgagccg       120
     gtgggctccc gcaacatttc tcgtttgatt tccgtcccgc tgtcgccggc ctcggtgcgc       180
     aatgtgatgg ccgacctcga acagctcggc ctgatctatg ccccgcacac ctcggccggg       240
     cggctgccga ccgaactcgg cctgcggttc ttcgtcgacg cgctgatgca gatcggcgac       300
     ctgaccgagc cggagcggca gtcgatccag gcgcagcttt cgtcagtagg acgtgcccat       360
     acggtcgaag ccgcgctcgg cgaggcgctg acgcggctgt cggggctgac acgcgccgcc       420
     gcggtggtgc tgaccgcgaa ggccaatgtc cggctcaagc acatcgaatt cgtccggctg       480
     gagccggagc gtgcgctggt gatcctggtg gccgaagacg gccaggtcga gaaccgcgtg       540
     ctaacgctgc cgccgggtgt gccgtcctcg gcgctgatcg aagcggccaa ttatctcaac       600
     gcccggattc gcggccggac gctggccgaa gcgcggctcg agctcgaatc gctgatggtt       660
     cagaacaagg cggaactcga tcagctgacc cagaaggtga tcgcggcggg aatcgccagc       720
     tggtccggcg gcgacggcga ggaccgccag ttgatcgtgc gcggccacgc caatctgctg       780
     gaagacctgc atgcgctcga tgatctggag cgggtgcggc tgcttttcga tgatctcgag       840
     accaagcgcg gggtgatcga tctgctcggc cgcgccgaga gcgccgacgg cgtgcggatc       900
     ttcatcggtt cggaaaacaa gctgttctcg ctgtcgggct cgtccaccat catcgccccc       960
     tacagcgacg gcgccggcca catcgtcggc gtgctcggcg tgatcgggcc gacccggctg      1020
     aactatgcgc gggtgatccc gatggtcgat tacacggcgc ggatcgtcag ccggatgctc      1080
     ggcggctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page