(data stored in ACNUC30630 zone)

EMBL: CP001096.PE332

CP001096.PE332       Location/Qualifiers
FT   CDS_pept        352519..353142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0334"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: GrpE protein; KEGG: bbt:BBta_0188 protein GrpE
FT                   (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98894"
FT                   /db_xref="GOA:B3Q970"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q970"
FT                   /protein_id="ACE98894.1"
FT                   /translation="MTETDGQKDNNQDTAQAAADPVVSKPYIMPDDPEEGSNEALVREA
FT                   ADARDKMLRTLAEMENLRKRTQKEVADARTYGVTSFARDVLDIADNLQRALDAVPAEAR
FT                   ANAEPGLKALIEGVELTERSLLNALEKNGVKKFDPKGQKFDPNFQQAMYEVPDPSVPAG
FT                   TVVQVVQAGFTIGDRVLRPALVGVAKGGAKAAPSDGGSETGNLN"
     atgaccgaga ctgatggaca gaaggacaac aaccaggaca cggcgcaggc cgccgccgat        60
     ccggtcgttt ccaagccgta catcatgccg gacgacccgg aagaaggatc gaacgaggca       120
     ctggtgcgcg aggctgcgga tgcgcgcgac aagatgctgc gtacgctcgc cgaaatggag       180
     aacctgcgga agcggaccca gaaggaagtc gccgacgctc gcacctatgg ggtgacctcg       240
     ttcgcgcgcg acgtgctcga tatcgccgac aatctgcagc gcgcgctcga tgcggtgccg       300
     gccgaggccc gcgccaatgc cgagcccggg ctcaaggcgt tgatcgaggg cgtcgagctg       360
     accgagcgct cgctgctcaa cgcgctcgaa aagaacggcg tcaagaagtt cgacccgaag       420
     ggccagaagt tcgatccgaa cttccagcag gcgatgtacg aagtgccgga tccgtcggtg       480
     ccggcaggca ccgtcgtgca ggtggttcag gccggcttca cgatcggcga ccgcgtgctg       540
     cgtccggcgc tggtcggtgt cgccaagggc ggcgccaagg ctgcgccgag cgatggcggc       600
     agcgagaccg gcaacctcaa ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page