(data stored in ACNUC30630 zone)

EMBL: CP001096.PE343

CP001096.PE343       Location/Qualifiers
FT   CDS_pept        complement(363756..364271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0345"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="KEGG: bbt:BBta_0200 putative membrane protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98905"
FT                   /db_xref="GOA:B3Q981"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q981"
FT                   /protein_id="ACE98905.1"
FT                   /translation="MAIEPDLGLDSREPKLFSARLKPHRALSHNGFLILIGLVGTASFA
FT                   AGLAFWMMGAWPVFGFFGLDVLALAFAFKVSFARARASEEISMTCSELRVRRTSARGEV
FT                   AEWVLNPLWVRLEKIVHHDAGIERLYLVSSGRRLAIASFLGAEEKANFAKALMAALDAA
FT                   RRGPLYPA"
     atggcgatag aacccgatct tggtctggat tcgagagagc cgaaactgtt ttcggctcgg        60
     ctgaagccgc atcgcgcctt gagtcacaat ggatttctaa tcctgattgg gctggtcggc       120
     accgccagtt tcgccgccgg gctggcattc tggatgatgg gcgcctggcc ggtgttcgga       180
     ttcttcgggc tggacgtgct ggcgctcgcg ttcgccttca aggtgagctt cgcccgcgcc       240
     cgggccagcg aggaaatctc gatgacctgc agcgaattgc gggtccgccg cacctcggcg       300
     cgcggcgaag tggccgaatg ggtgctgaac ccgctgtggg tgcggctgga aaagatcgtc       360
     caccacgacg ccggcatcga gcggctgtat ctggtctcgt caggccgccg gctggcgatc       420
     gcgagttttc tcggcgcgga agaaaaagcg aacttcgcca aggccttgat ggcggcgctc       480
     gacgccgcgc ggcgcggtcc gctgtacccg gcctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page