(data stored in ACNUC30630 zone)

EMBL: CP001096.PE352

CP001096.PE352       Location/Qualifiers
FT   CDS_pept        374082..374903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98914"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q990"
FT                   /protein_id="ACE98914.1"
FT                   /translation="MAKNKKIARKFATDQANLLENSIRRELDWAGDRSVVEKGSATDKK
FT                   NYAEGLSRALSQRFADALRKSFDGILPDVDGFGQESKARTGKGLKKLDVNYSTVELGLG
FT                   LGVSIKTINFRDAKTKRYTKNYTRVDNELRAEAADYHERQPYAVLCAVVFIPLDACDDG
FT                   GSAPSSFGQAVQIFRYRAGRERPVDDATLFERILVGLYDAGSPCFGTTGFFDVMDAPPR
FT                   TGRPSALMTFEQAIDKIVEAYDARNKSAFKWAEGETEILAAPEAEDDEDET"
     atggcgaaga acaagaagat cgcgcgaaaa ttcgcgaccg accaggcgaa cctcttggag        60
     aattcgatcc gacgcgagct cgattgggcc ggggaccgga gcgtcgtcga gaaaggatcg       120
     gcgaccgaca agaagaacta tgccgaaggc ctctcgcgtg cgctgtcaca gcgcttcgcc       180
     gacgcgcttc gaaagtcgtt cgacggtatt ttgcccgacg tcgatggatt cggccaagag       240
     tcgaaggcgc gaaccggcaa gggtttgaag aagctggacg taaactattc caccgtggaa       300
     ttgggcctcg gcctcggcgt atcgatcaag accatcaact tccgcgacgc caagacgaag       360
     cgctatacga agaattacac acgagtcgac aacgagctcc gagccgaagc cgcggactac       420
     cacgagcgac agccgtatgc ggtgctgtgc gcggtggtgt tcattccgct cgacgcttgc       480
     gacgatggag gaagtgcgcc gtcaagtttc ggccaagccg tccaaatctt tcgctaccgg       540
     gcggggcgcg aaagaccggt cgacgatgcg acgctgttcg agcgaattct cgtcggtctg       600
     tatgatgcgg gctcgccgtg cttcggaaca accgggttct tcgacgtgat ggatgcgccg       660
     ccacgaaccg gacgtccttc tgcgctgatg accttcgagc aagcgatcga caagatcgtc       720
     gaggcgtacg acgcacgcaa caaatccgcc ttcaaatggg cggagggcga aaccgaaata       780
     ttggccgcgc ccgaggcaga ggacgacgag gacgaaacgt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page