(data stored in ACNUC30630 zone)

EMBL: CP001096.PE353

CP001096.PE353       Location/Qualifiers
FT   CDS_pept        complement(374910..376721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0355"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; GTP-binding protein LepA domain protein;
FT                   KEGG: bja:blr8150 GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98915"
FT                   /db_xref="GOA:B3Q991"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q991"
FT                   /protein_id="ACE98915.1"
FT                   /translation="MTTAPIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKE
FT                   QVLDSMDIERERGITIKAQTVRLKYRAHDGKDYIFNLMDTPGHVDFAYEVSRSLAACEG
FT                   SLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDAS
FT                   DAVMISAKTGLGVPDVLEAIVTRLPPPKGDRDATLKALLVDSWYDVYLGVVVLVRVVDG
FT                   VLKKGQRIRMMGTGAAYDVERVGYFTPKMVNVEELGPGEVGFITAAIKEVADTRVGDTI
FT                   TDDKKPVTDMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAA
FT                   LGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVIYKMKLTDGTEMEIHNPVDMPD
FT                   VVKIAEIEEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVV
FT                   FDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRA
FT                   MVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQK
FT                   EGKKKMRQFGKVDIPQEAFIAALKVDS"
     atgacaaccg cccccatcga caacatccgc aacttctcca tcgtcgccca tatcgaccat        60
     ggcaagtcga cgctcgccga ccgcctgatc cagatcaccg gcggcatgtc cgaccgtgaa       120
     atggccggca aggagcaggt gctcgattcg atggacatcg agcgtgagcg cggcatcacc       180
     atcaaggcgc agaccgttcg tctgaaatac cgcgcccatg acggcaagga ctacatcttc       240
     aacctgatgg acacgcccgg ccacgtcgac ttcgcctacg aagtgtcgcg gtcgctggcg       300
     gcgtgcgaag gctcgctgct ggtggtggac gccagccagg gcgtcgaagc gcagacgctc       360
     gccaacgtct atcacgcgct cgacgccggc cacgagatcg tgcccgtgct caacaaggtc       420
     gatttgccgg ccgccgagcc cgagaagatc aagcagcaga tcgaggacgt gatcggcctc       480
     gacgcctccg acgcggtgat gatctcggcc aagaccggcc tcggcgtgcc cgacgtgctg       540
     gaagcgatcg tcacccggct gccgccgccc aagggcgacc gcgacgccac cctgaaggcg       600
     ttgctggtcg atagctggta cgatgtctat ctcggcgtcg tggtgctggt gcgggtcgtc       660
     gatggcgtgc tcaagaaggg ccagcgcatc cggatgatgg gcaccggcgc cgcctacgac       720
     gtcgagcgcg tcggctattt cacgcccaag atggtcaacg tcgaagaact cggccccggc       780
     gaagtcggct tcatcaccgc ggcgatcaag gaagttgccg acacccgcgt cggcgacacc       840
     atcactgacg acaagaagcc ggttaccgac atgctgccgg gcttcaagcc ggcgatcccg       900
     gtggtgttct gcggcctgtt cccggtcgac gccgacgatt tcgagacgct ccgcgccgcg       960
     atgggcaagc tgcgactgaa cgacgccagc ttctcgttcg agatggagac ctcggccgcg      1020
     ctcggcttcg gcttccgctg cggcttcctc ggcctgctgc atctggagat catccaggag      1080
     cggctcagcc gcgagttcga cctcgacctg atcgcgaccg cgccgagcgt gatctacaag      1140
     atgaagctca ccgacggcac cgagatggag atccacaatc cggtcgacat gccggacgtg      1200
     gtgaagatcg ccgagatcga ggagccgtgg atcgaagcca cgatcctgac gcccgacgaa      1260
     tacttgggct cggttctgaa gctgtgccag gatcgccgcg gcaatcagaa agagctgacc      1320
     tacgtcggcg cccgcgcgat ggtgaagtat gacttgccgc tcaacgaggt ggtgttcgac      1380
     ttctacgacc ggctgaagag cgtgtcgaag ggctacgcct cgttcgacta tcacctcacc      1440
     gactacaagc cggccgatct cgtcaagatg cagatcctgg tcaatgccga gccggtcgac      1500
     gcgctgtcga tgctggtgca ccggacgcgc gccgaaggcc gcggccgcgc catggtcgag      1560
     aagatgaaag agctgatccc gccgcacatg ttccagatcc cgatccaggc ggcgatcggc      1620
     ggcaaggtga tcgcccgcga aaccgtccgc gccctgcgca aggacgtcac cgccaagtgc      1680
     tacggcggcg acatcacccg aaagcgcaaa cttctggaga aacagaagga gggcaagaag      1740
     aagatgcggc agttcggcaa ggtcgacatc ccacaggaag cgttcattgc cgcattgaag      1800
     gtggatagtt ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page