(data stored in ACNUC30630 zone)

EMBL: CP001096.PE354

CP001096.PE354       Location/Qualifiers
FT   CDS_pept        376866..378404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO0839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98916"
FT                   /db_xref="GOA:B3Q992"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q992"
FT                   /protein_id="ACE98916.1"
FT                   /translation="MSPRSTPRRPFAPLTRWLDALLDPKRQELTVIWTLLAYMAVWTAY
FT                   RIIATWPRDLHADETELYGWSRHLALGTDKHPPFSAWVARAWFTLVPPSDLSVHLLATA
FT                   NIALTLYIAWRTMRRYMDAEKSLFGLALLTLIPFFNFIALKYNANAVLLPLWALTIHCF
FT                   LRALESRAVLWGALAGVFAGASMLGKYWSIVLVVALGLAALIDPRRGRFFASPAPWLMI
FT                   LCGGLVLGPHVWWLADHGFPTLAYAAAHESADLADNLRDTLTYLPGAVAYAAVALITAA
FT                   VVLRPSRAALADIAWPAGSERRTILLIQLLLIVAPMPVALATGIRIVPLWAMPAYTLLP
FT                   IVLLASPLIAVGRDAVRRCLIVASAVSLGSLALSPVVALVIHLSDPPGPFEYASLLADH
FT                   VDREWRRNIDEPVPLVAGETVLAENTAFYLRTDTLGFETADLAALKQRAAARGAILVCP
FT                   ADDKGCIATAEQIIAGQPQILRGKVWLSRPLFGQPGGRVSDVFFLVLPTERSAK"
     atgtcccctc gttccacccc ccgccgcccc ttcgctccac tgacgcgctg gctcgacgcc        60
     ctgctcgatc ccaagcggca ggagcttacc gttatctgga cgctgctcgc ctatatggcg       120
     gtctggaccg cgtaccggat catcgccacc tggccgcgcg atctgcatgc cgacgagacc       180
     gagctgtatg gttggtcgcg gcatctggcg ctcggcaccg acaagcatcc gccgttctcg       240
     gcctgggtgg cgcgcgcctg gttcacgctg gttccgccgt ccgacctgtc ggtgcatctg       300
     ctggcgaccg ccaatatcgc gctgacgctg tacatcgcct ggcggacgat gcggcgctac       360
     atggacgccg agaagtcgct gttcgggctg gcgctgctga cgctgatccc gttcttcaat       420
     ttcatcgccc tgaaatacaa tgccaatgcg gtgctgctgc cgctgtgggc actcaccatc       480
     cattgcttcc tgcgcgcgct ggaaagccgc gccgtgctgt ggggggcgct tgcgggtgtg       540
     ttcgccggcg cctcgatgct cggcaaatat tggtcgatcg tgctggtcgt cgcgctcggg       600
     ctggcggcgc tgatcgatcc gcggcgcggc cggttcttcg cctcaccggc gccgtggctg       660
     atgatcctat gcggcggcct ggtgttgggc ccgcatgtct ggtggctggc cgaccacggc       720
     tttccgacgc tcgcctatgc ggccgcgcac gagtcggccg acttggccga taacctgcgg       780
     gatacgctca cctatctgcc cggcgccgtc gcctatgcgg cggtggcgct gatcaccgcc       840
     gcggtggtgc tgcggccgtc gcgcgcggcg ctggccgaca tcgcgtggcc cgctgggtcg       900
     gagcggcgca ccatcctgct gatccagctg ctgctgatcg tggcgccgat gccggtggcg       960
     ctggcgaccg gtatccggat cgttccgcta tgggcgatgc cggcctacac gctgctgccg      1020
     atcgtgctgc tggcctcgcc gctgatcgcg gtcggacgcg acgcggtgcg gcgctgcctg      1080
     atcgttgcgt ccgcggtgtc gctcggctcg ctggcgctgt cgccggtggt ggcgctggtg      1140
     atccacctca gcgatccgcc tggaccgttc gaatacgcct cgctgctcgc cgaccacgtc      1200
     gaccgcgaat ggcgccggaa catcgacgag ccggtgccgc tggtcgccgg tgaaaccgtt      1260
     ctggccgaga acaccgcgtt ctatctgcgc accgacacgc tgggcttcga aaccgcggac      1320
     ctcgccgcgc tgaagcagcg ggcggcggcg cgcggcgcca tcctggtgtg cccggccgac      1380
     gacaagggct gtatcgccac cgctgagcag atcatcgccg gccagcccca gatccttcgc      1440
     ggcaaggtgt ggctcagccg gccgctgttc ggacagccgg gcggacgggt cagcgacgtg      1500
     ttcttcctgg tgctgcctac agagagaagc gcgaaatag                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page