(data stored in ACNUC30630 zone)

EMBL: CP001096.PE374

CP001096.PE374       Location/Qualifiers
FT   CDS_pept        401242..401727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0376"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   oan:Oant_0505 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98936"
FT                   /db_xref="GOA:B3Q9B2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B2"
FT                   /protein_id="ACE98936.1"
FT                   /translation="MVNPAKITLDAIDLKILAELQADARIPNIVLAQKVGLSPSPCSRR
FT                   VKLLEQAGVLASYRALVDRAAVGLAVTAFAFIRVERHSRDNAESFIEAVQTMPEVIACH
FT                   LVSGDSDFLLEVVVPDIASYETTVLRGLLALPTVRDIRTSFAMRSYKLSGPLPLPAA"
     atggtcaatc ctgctaaaat caccctggat gcgatcgacc tgaaaatcct tgccgagctg        60
     caggccgacg cccggattcc gaatatcgtg ctggcccaga aggtcgggtt gtcgccgtcg       120
     ccatgctcgc ggcgggtcaa gctcttggag caggccggcg tgctggcgag ctatcgggcg       180
     ctggtcgacc gcgccgcggt cgggctagcg gtcacggcgt ttgctttcat tcgggtcgag       240
     cggcattccc gcgacaatgc cgagagcttc atcgaagccg tgcagaccat gccggaagtg       300
     atcgcctgcc atctggtgtc cggagacagc gacttcctgc tcgaagtggt agtgccggac       360
     atcgccagct atgagaccac cgtgctgcgg ggcctgctgg cgctgccaac agtgcgcgac       420
     atccgcacct cgttcgcgat gcgcagctac aagctcagcg ggccgttgcc gctgccggcg       480
     gcgtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page