(data stored in ACNUC30630 zone)

EMBL: CP001096.PE375

CP001096.PE375       Location/Qualifiers
FT   CDS_pept        complement(401728..402165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0377"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: mlo:mll6589 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98937"
FT                   /db_xref="GOA:B3Q9B3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B3"
FT                   /protein_id="ACE98937.1"
FT                   /translation="MSDHLVVCTHCGGVNRLPEQRPALDGKCGKCGHRLFEGHPADVSG
FT                   DQFDKQVSRSSVPVLVDVWAPWCGPCRAMAPAYEQAARELEPNVRLIKLNSDNEQQVAG
FT                   RLGIQGIPTMILFDNGRERARTSGAMPAGEIVRWVRQHLPA"
     atgtccgacc atctcgtggt gtgcacgcat tgcggcgggg tcaatcggct gccggagcag        60
     cggccggcgc tggacggcaa atgcggcaag tgcggtcata gactgttcga aggccatccg       120
     gccgacgtca gcggcgatca gttcgacaag caggtgtcgc gcagcagcgt gccggtgctg       180
     gtcgatgtct gggcgccatg gtgtgggcca tgccgggcaa tggcgccggc ctacgagcag       240
     gcagcgcgtg agctggagcc gaatgtccgc ctgatcaagc tcaactccga caacgaacag       300
     caggtcgccg gccggctcgg catccagggc atcccgacca tgatcctgtt cgacaacggg       360
     cgcgagcgcg cccggacctc gggcgcgatg ccggcgggag agatcgtgcg ctgggtgaga       420
     cagcacctgc cggcgtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page