(data stored in ACNUC30630 zone)

EMBL: CP001096.PE376

CP001096.PE376       Location/Qualifiers
FT   CDS_pept        complement(402305..403288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0378"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bja:blr6070 putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98938"
FT                   /db_xref="GOA:B3Q9B4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B4"
FT                   /protein_id="ACE98938.1"
FT                   /translation="MDAMVLTAPGTSLQWQSRDTPQPGDGEVLVTVSACGVCRTDLHVV
FT                   DGELPNIRYPIIPGHEIVGRVAAVGAGVTTHQIGDRVGIPWLGHTCGLCRYCRSGMENL
FT                   CDAPLFTGYTRDGGFASHAIADARYAFPLGEAGDDVAIAPLLCAGLIGWRSLAIAGDAE
FT                   RLGIYGFGAAGHIVAQVARWQGRQVYAFTRGGDVAAQDFARSLGAMWAGASEELPPEPL
FT                   DAAIIYAPVGSLVPAALKAVRKGGRVVCAGIHMSDIPSFPYDLLWEERQLVSVANLTRQ
FT                   DGVDFLEVAQQAGIRTETHAFPLREANTVLNKLRAGELLGAAVLVP"
     atggatgcga tggtgctgac agcaccgggc acgtcgctgc aatggcaatc gcgcgacacg        60
     ccgcagccgg gtgacggcga ggtgctggtc acggtgagcg cttgcggcgt ctgccgcact       120
     gaccttcacg tcgtcgatgg cgaattgccg aacatccgtt atccgatcat tcccggccat       180
     gagatcgtcg gccgcgtcgc ggcggtcggc gctggcgtca ccacacatca gatcggtgac       240
     cgcgtcggca ttccctggct cggccacact tgtgggctgt gccggtactg ccgaagcggc       300
     atggagaatc tgtgcgatgc gccgctgttc accggctaca cccgcgacgg cggatttgcg       360
     tctcacgcca tcgccgacgc gcgctacgcg tttccgctcg gcgaggccgg cgatgacgtt       420
     gcgattgcgc cgctgctgtg cgccggactg atcggctggc gttcgctggc gatcgccgga       480
     gacgcagagc ggctcggaat ctacggcttc ggcgccgccg gccatatcgt ggcgcaggtc       540
     gcgcgctggc aaggacggca ggtgtacgcc ttcacccgcg gcggcgatgt cgcggctcag       600
     gacttcgccc gcagcctcgg cgcaatgtgg gccggcgcct cggaagaatt gccgcccgag       660
     ccgctcgacg ccgcgatcat ctacgcgccg gtcggcagcc tggtgccggc cgcgctgaag       720
     gcggtgcgca aaggcggccg cgtggtgtgc gccggcatcc atatgagcga catcccgagc       780
     tttccgtatg acctgctgtg ggaggaacgc cagctcgttt cggtcgccaa cctcacccgg       840
     caggacggtg tcgattttct tgaggtggcg cagcaggccg gcatccggac cgagacccac       900
     gccttcccgc tacgtgaggc caacacggta ttgaacaaac tccgcgccgg cgaactgctc       960
     ggtgcggcgg tgctggtgcc atag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page