(data stored in ACNUC30630 zone)

EMBL: CP001096.PE378

CP001096.PE378       Location/Qualifiers
FT   CDS_pept        403814..404536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0380"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: nha:Nham_1929 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98940"
FT                   /db_xref="GOA:B3Q9B6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9B6"
FT                   /protein_id="ACE98940.1"
FT                   /translation="MTSPASDLPPLSGRSFAVLRELMVERQIAARGLHDPRVLAAMRKV
FT                   PREAFLPEPMRDLAYEDAPVPIAAEQTMSQPYIVALMVEALLLQGSDNVLEIGAGSGYA
FT                   AAVLGEIAGHVTTVERIATLADAAAAKLAELGYGHVDVHRSDGTRGWAAAAPYDAIVVA
FT                   AGGPQVPESLKAQLKIGGRLVMPVGANQQAQELVRLTRLGEADFKREHLGDVRFVPLLG
FT                   SEGWQQPEPAGRTAREKG"
     atgacgtctc cagcttcgga cttgccgcca ctcagcgggc ggtcgttcgc ggtgctgcgc        60
     gagttgatgg tcgagcgcca gattgcagcg cgcggcctgc atgatccgcg cgtgcttgcc       120
     gcgatgcgca aggtgccgcg cgaagccttc ctgcccgaac cgatgcgtga tctggcgtac       180
     gaagacgcgc cggtgccgat cgccgccgag cagacgatgt cgcagcccta catcgtggcg       240
     ctgatggtcg aggcgctgtt actgcagggc agcgacaacg tgctcgaaat cggcgccggc       300
     tccggctacg ccgccgcggt gctcggcgag atcgccggtc atgtcaccac ggtggagcgc       360
     atcgctacgc tggcggacgc tgcggcggcg aagctcgccg agcttggtta cggccatgtc       420
     gacgtgcatc ggagcgatgg cacccgcggt tgggccgccg cggcgcctta cgacgcgatc       480
     gtggtcgccg ccggcgggcc gcaggtgccg gagtcgctga aggcccagct caagatcggc       540
     ggacggctgg tgatgccggt tggagccaat cagcaagccc aggaactggt gcggctgaca       600
     cggctcggtg aggccgattt caagcgcgag cacctcggtg atgttcgctt cgtgccgctg       660
     ctcggctctg agggctggca gcagccggag ccggccggca ggacggcacg cgaaaaggga       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page