(data stored in ACNUC30630 zone)

EMBL: CP001096.PE387

CP001096.PE387       Location/Qualifiers
FT   CDS_pept        complement(415092..415811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0389"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: nwi:Nwi_0335
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98949"
FT                   /db_xref="GOA:B3Q9C5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q9C5"
FT                   /protein_id="ACE98949.1"
FT                   /translation="MPTDNAERLQQPGFAEAPHYHGHRERLRERFREAGSDALSDYELL
FT                   ELVLFRALPRRDVKPIAKELIARFGSFAEAVHAPAERLREVSGVGEAAIIEIGLIAAAA
FT                   ARVTKGQVKQRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVD
FT                   HTPVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADIQMTKSIVAIAEPLGIAVHDH
FT                   IIVGKNGHASLKGLRLI"
     atgccgacag acaacgccga gcgactgcag cagccaggat ttgccgaagc gccgcattat        60
     catggccatc gcgagcggct gcgggagcgg tttcgcgagg ccggttccga cgcgctatcc       120
     gactacgaac tgctcgaact ggtgctgttc cgggcgctgc cgcgccggga cgtcaaaccg       180
     atcgcgaagg agctgatcgc ccggttcggt tcgttcgccg aggcggtgca tgcgccggcc       240
     gaacggctgc gcgaagtcag cggggtcggc gaagccgcca tcatcgagat cggactgatc       300
     gcggctgcgg ctgcgcgggt gaccaagggg caggtgaagc agcgcaccgt gctgtcgtcc       360
     tggtcggcgg tgatcgacta ttgccgcacc accatggcgt tcgccgacaa ggagcagttc       420
     cgaatcctgt ttctcgacaa gcgcaaccag ctcatcgccg acgaactgca gcaggtcggc       480
     accgtcgacc acacgccggt atatccgcgc gagatcgtca aacgcggatt ggaattgtcg       540
     gcgaccgctg tgatcatggt tcacaatcac ccctcgggcg atccgacgcc gtcacaggcc       600
     gatattcaga tgacgaaatc gatcgtggcg atcgccgagc ctctcggcat cgcggtgcac       660
     gaccacatca tcgtcggcaa gaacggccac gccagtctca agggcctgag gctgatttga       720
//

If you have problems or comments...

PBIL Back to PBIL home page