(data stored in ACNUC30630 zone)

EMBL: CP001096.PE399

CP001096.PE399       Location/Qualifiers
FT   CDS_pept        complement(429106..430305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0401"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: bbt:BBta_0241 putative
FT                   pyruvate formate lyase activating enzyme 2 (YfgB)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98961"
FT                   /db_xref="GOA:B3Q9D7"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q9D7"
FT                   /protein_id="ACE98961.1"
FT                   /translation="MTPSAASALVEKTPLETYVPPAKPSLIGLSRAQLCDRLGDVGVAP
FT                   PQRKMRAQQLWHWMYVRGARDFSEMTNVSKEMRATLAEHFTVDRPEVVAEQISADGTRK
FT                   WLLRLPSGGDGQKAHEVECVYIPETDRGTLCVSSQVGCTLNCAFCHTGTQRLVRNLTAG
FT                   EIVGQVMVARDRLGDWIDRETPNGNRLITNIVMMGMGEPLYNFDAVRDALLIVSDNEGI
FT                   GISRRRITLSTSGVVPNIKRTGDEIGVMLAISLHAVRDELRDELVPLNRKYPLKELLQA
FT                   CRDYPGASNARRITFEYVMLKGVNDSLDDARKLVQLLKGIPAKINLIPFNPWPGSNYEC
FT                   SDWDQIEKFSEYVFNAGYSSPVRTPRGRDILAACGQLKSETEKLSVRERNALRAMAMTD
FT                   "
     atgacgcctt ctgcagcctc ggccctggtc gagaagaccc cgctggaaac ctatgtgccg        60
     ccggccaagc cgtcgctgat cgggctgtcg cgggcgcaat tgtgcgaccg gctcggcgac       120
     gtcggggtgg cgccgcccca gcgcaagatg cgggcgcagc agctctggca ctggatgtat       180
     gtccgcggcg cccgtgactt ctccgaaatg accaatgtct ccaaggagat gcgggcaacg       240
     ctggcggagc acttcacggt cgaccggccc gaagttgtgg ccgagcagat ttcggccgac       300
     ggcacccgca aatggctgct gcggctgccg agcggcggcg acggccaaaa ggctcacgag       360
     gtcgagtgcg tctatatccc ggagaccgac cgcggcacgc tgtgcgtctc cagccaggtc       420
     ggctgcaccc tgaattgcgc gttctgtcac accggcaccc agcgcctggt gcgcaacctc       480
     acggccggcg agatcgtcgg ccaagtgatg gtggcgcgcg accggctggg tgactggatc       540
     gaccgcgaga caccgaacgg caaccgcctg atcaccaaca tcgtgatgat ggggatgggc       600
     gagccgctgt acaatttcga tgcggtgcgc gacgcgctgc tgatcgtctc cgacaatgaa       660
     ggcatcggca tctcgcggcg gcggatcacg ctgtcgacct ccggcgtggt gccgaacatc       720
     aagcgcaccg gcgacgagat cggcgtgatg ctggcgattt cgctgcacgc ggtgcgcgac       780
     gaactccgcg acgagctggt gccgctgaac cgcaaatatc cgctgaagga attgctacag       840
     gcctgccgcg actatccggg cgcgtccaac gctcgccgca tcaccttcga atacgtgatg       900
     ctgaagggcg tcaacgactc gctcgacgat gcgcgcaagc tggtacagtt gctcaagggg       960
     attccggcca agatcaatct gatcccgttc aatccatggc cgggctcgaa ctacgagtgc      1020
     tcggactggg accagatcga gaagttctcg gaatacgttt tcaacgccgg ctactcgtcg      1080
     ccggtgcgca ccccgcgcgg ccgcgacatt ctggcggcct gcggccagct caaatccgaa      1140
     accgaaaagc tctcggtgcg cgaacgcaac gcgctccgcg cgatggcgat gacggactga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page