(data stored in ACNUC30630 zone)

EMBL: CP001096.PE411

CP001096.PE411       Location/Qualifiers
FT   CDS_pept        445043..446311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0413"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bja:blr0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98973"
FT                   /db_xref="GOA:B3QA87"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA87"
FT                   /protein_id="ACE98973.1"
FT                   /translation="MPSSSFPSSVDIAIIGAGAAGLGAARTLEGTGLSVIVLEARNRIG
FT                   GRAWTRMVTPEIAFDVGCGWLHSADENSFVGIAKQLGIGIDKTHPPWGEASFGDVFPKR
FT                   DRAAFGKALDAFYERVWRAAKNKTDVAAATLLEPGNRWNPMIDAVSTYVNGAELDRISV
FT                   HDLESYRDTGINWRVREGYGTLIAAYGEPCPVALNCVVEQIDHSERRIKINTSLGTLSA
FT                   SQVIITVPTNLIADEAIRFVPALPGKVEAARHLPLGVDDKVMLKLSDSNGFPADGNLRA
FT                   ATMRSAMGTYHLRPFGHDCIEGFFGGRYARELEDAGEGAFAAQAIDEIADLLGNDIRRK
FT                   LSPLAESRWAHDPFARGAYSHALPGHAGARAVLAAPVDGRLFFAGEATSPQFFSTAHGA
FT                   RDSGERAARQAIDCRSGPGFAAN"
     atgccatcat ccagctttcc gtcctcggtc gacatcgcga tcatcggcgc cggcgcggct        60
     ggcctcggcg cggcgcggac gctggaaggg acgggcctgt cggtgatcgt gctggaagcg       120
     cggaaccgga tcggcggccg agcctggacc cggatggtga cgccggagat cgcattcgac       180
     gtcggctgcg gctggctgca ttcggccgac gaaaactcat tcgtcggcat cgccaagcag       240
     ctcggcattg gcatcgacaa gacgcatcca ccgtggggcg aggcgagctt tggcgatgtg       300
     tttcccaagc gcgatcgcgc cgccttcggc aaagcactcg acgcgttcta cgaacgggtc       360
     tggcgtgcgg cgaaaaacaa gaccgatgtg gctgcagcga cgctactcga gcctggcaac       420
     cgctggaatc caatgatcga tgcggtctcg acctacgtca acggcgccga gctcgatcgc       480
     atctcggtgc acgatctcga atcctatcgc gacaccggca tcaactggcg ggttcgcgaa       540
     ggctacggca cgctgatcgc ggcttacggc gagccttgcc ccgtggcgct gaactgtgtg       600
     gtcgagcaga tcgatcactc cgagcggcgg atcaaaatca acacctcgct cggcacgctc       660
     agcgccagcc aggtcatcat cacggtgccg accaatctga ttgccgacga ggcgatccgg       720
     ttcgtgcccg cgctgccggg caaggtcgag gccgcgcgcc atttgccgct cggcgtcgac       780
     gacaaggtga tgctgaagct ctccgactcg aatggttttc ctgccgacgg caatctgcgt       840
     gccgccacga tgcggagcgc gatggggacg tatcacctgc gcccgttcgg ccatgattgt       900
     atcgaaggct ttttcggcgg ccgctacgcg cgcgagctgg aggacgccgg cgagggggct       960
     ttcgccgcgc aggcgatcga cgagatcgcc gatctgctcg gcaacgacat ccgccgtaag      1020
     ctgtcgccgc tggcggaatc gcgctgggcg cacgacccgt tcgcgcgcgg cgcctattcg      1080
     catgcgctgc ccggccatgc cggtgcccga gccgtgctgg cggcgccggt cgatggccgg      1140
     ctgttcttcg ccggagaggc gacctcgccg cagttcttct cgaccgcgca tggcgcgcgt      1200
     gattcgggcg agcgtgcagc gcgacaagcg atcgattgtc gcagcggccc aggttttgcg      1260
     gcgaactaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page