(data stored in ACNUC30630 zone)

EMBL: CP001096.PE416

CP001096.PE416       Location/Qualifiers
FT   CDS_pept        complement(450309..450635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0418"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   nwi:Nwi_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98978"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QA92"
FT                   /protein_id="ACE98978.1"
FT                   /translation="MAEAWRYSAQGVAVAVRVTPRGGRDDIDGLETLSDGRPVVKVRVR
FT                   AIADGGEANRAVTELLAKAVGVPKRNVRLLSGATSRQKQIAIDGDPKQLGEALRRLVAA
FT                   KPAE"
     atggcggaag cttggcggta ttcggctcag ggcgttgcgg tggcggtgcg ggtcaccccg        60
     cgcggcggcc gcgatgacat cgacgggctg gagacgctgt ccgacggtcg gccggtggtc       120
     aaagtgcggg tccgggcaat cgccgacggc ggcgaggcca accgcgcggt gaccgagctg       180
     ctggcgaaag cggtcggggt gccgaaacgc aatgtcaggc tgctgtccgg cgcgacatcg       240
     cggcaaaaac agatcgcgat cgacggcgat ccaaaacagc tcggcgaggc gttgcgccgc       300
     ctggtggcgg ccaagcccgc cgaatga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page