(data stored in ACNUC30630 zone)

EMBL: CP001096.PE417

CP001096.PE417       Location/Qualifiers
FT   CDS_pept        complement(450661..450951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0419"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   nwi:Nwi_0478 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98979"
FT                   /db_xref="GOA:B3QA93"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA93"
FT                   /protein_id="ACE98979.1"
FT                   /translation="MRAILDIVLIILDLYIWLLIASAILSWLIAFNVVNTRNQFVGAVS
FT                   EFLYRITEPLLAPIRNLLPSLGGLDISPIILILLIMFLQRVITYYIYPAVF"
     atgcgcgcca ttctcgacat cgttctcatc atcctcgatc tctacatctg gctgctgatc        60
     gcctcggcga tcctgtcctg gctgatcgcc ttcaacgtgg tgaacacgcg caaccagttc       120
     gtcggcgcgg tgtccgagtt cctgtaccga atcaccgagc cgctgctggc gccgatccgc       180
     aatctgctgc cctcgctcgg cggtctcgac atctcgccga tcatcctgat ccttctgatc       240
     atgttcctgc agcgggtgat cacctattac atctacccgg cggtgttcta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page