(data stored in ACNUC30630 zone)

EMBL: CP001096.PE419

CP001096.PE419       Location/Qualifiers
FT   CDS_pept        complement(452323..452823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0421"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="KEGG: vei:Veis_3840 protein of unknown function
FT                   DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98981"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA95"
FT                   /protein_id="ACE98981.1"
FT                   /translation="MTSEEFARLLESLTRAAESGDGARFAGHFTEDATYHDYIYGPHIG
FT                   RAEIATMMQDLFHRDAADYRWEMFDPVCNGDLGYAWSLSSFTSTVPEFKGQRVVIDGMS
FT                   RFILRGELIAEYRESVNGGVAMAQLGVAPERMAKVFRKWSGWLQHRPETQDYLARPKGT
FT                   RRT"
     atgacgagcg aggagttcgc gcggctgctg gagagcctga cccgcgcggc ggaatccggc        60
     gacggcgcac ggttcgccgg ccatttcacc gaagacgcga cgtatcacga ctacatctac       120
     ggcccgcaca tcggccgcgc cgagatcgcc acgatgatgc aggatctgtt tcatcgcgac       180
     gccgccgatt atcgctggga gatgttcgac ccggtctgca acggcgacct cggctacgct       240
     tggtcgttgt ctagcttcac ctccaccgtt cccgagttca aaggccagcg cgtggtgatc       300
     gacggcatga gccggttcat cctgcgcggc gagctgatcg cggagtatcg cgagtcggtc       360
     aatggcggcg tggcaatggc gcagctcggc gtcgcgcccg agcggatggc gaaggtcttc       420
     cgcaaatgga gcggctggct gcagcatcgc cccgaaaccc aggactatct ggcccggccc       480
     aaaggcacgc gccgcacctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page