(data stored in ACNUC30630 zone)

EMBL: CP001096.PE423

CP001096.PE423       Location/Qualifiers
FT   CDS_pept        complement(455471..456856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0425"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bbt:BBta_0276 putative
FT                   cytochrome P450 hydroxylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98985"
FT                   /db_xref="GOA:B3QA99"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B3QA99"
FT                   /protein_id="ACE98985.1"
FT                   /translation="MSIAAIDDRPASRAPLIPPTPPRAPENLSALGRLAAIRQNAIASW
FT                   GDRAYQDDVVRGRFFAHSSYILNTPDAIRHVLVDNTDNYRRTATGIRVLRPMLGEGLLL
FT                   AEGRAWKHQRRTLAPAFTPRAVATLVPHMASATDEVVEGLRRKTGVPLDLRETMQHLAL
FT                   EIAGRTMFSFEMGTHGQALRGFVIDYGTRLASPRFLDLLLPLGWPTPQDVSRALFRRRW
FT                   TRFIGELIAARRAAGKAEGAPPRDLFELMLAARDPETGEAFSDAQLGDQVATMILAGHE
FT                   TTATALFWALYLLALDPDAQERLANEVRRVGPGGTEIERLPFTRAVLDETLRLYPPAFL
FT                   IVREAAGPDQVAGFAVRKHDVMLIAPWLLHRHDKLWSDPNAFVPERFLPGAPSPDRFAY
FT                   LPFGVGPRVCIGAHFALVEATLALAKIVGTFRIELIDSEPVIPIGVVTTQPDRSPPFRL
FT                   TPR"
     gtgagcatcg ccgcaatcga cgaccgcccg gcatcccgtg caccgctgat cccgccgacg        60
     cccccgcgtg cgccggagaa tctctcggcg ctcggccggc tcgcggcgat ccgccaaaat       120
     gcgatcgcga gctggggcga ccgcgcctac caggacgatg tcgtcagggg ccggttcttc       180
     gcccattcca gctacatcct caacacgccg gacgcgatcc ggcacgtgct ggtcgataac       240
     actgacaact atcgccgtac cgccaccgga attcgcgtgc tgcggccgat gctcggcgag       300
     ggacttctgc tggccgaagg ccgcgcctgg aagcatcagc gccggacgct ggcgccggca       360
     ttcaccccgc gggccgtcgc aacgctggtg ccgcatatgg cgtcggcgac ggacgaggtt       420
     gtcgaggggc tgcgtcgcaa gaccggcgtc cccctggact tgcgcgaaac catgcagcat       480
     ctggcgctgg agatcgccgg gcggacgatg ttctcgttcg agatggggac gcacggccag       540
     gcgctgcgcg gctttgtgat cgactacggc acccggctgg cgagcccgcg atttctcgat       600
     ctgctgctgc cgctcggctg gccaacgcca caggatgttt cgcgcgcgct gtttcgccgg       660
     cgctggaccc gattcatcgg cgaactgatc gctgcgcggc gcgcggccgg caaggccgaa       720
     ggcgccccgc cgcgcgacct gttcgaactg atgctggcgg cccgcgaccc ggaaaccggc       780
     gaagcgttct ccgacgcgca gctcggcgat caggtcgcca ccatgatcct ggccggccac       840
     gagacaaccg ctacggcgct gttctgggcg ctgtacctgc tggcactgga tcccgacgcc       900
     caggagcgat tggccaatga agttcgccgg gtcggccccg gtgggaccga gatcgagcgg       960
     ctgccattca cccgtgcggt gctcgacgag acgctgcggc tatatccgcc cgcgttcctg      1020
     atcgtgcggg aagcagcggg gcccgaccag gtcgcgggct tcgccgtccg caagcacgac      1080
     gtgatgctga tcgcgccatg gctgctgcac cggcacgaca agctctggag cgatccgaac      1140
     gcgttcgtac cggagcgctt tctgccgggc gccccctcac cggaccggtt cgcctacctg      1200
     ccgttcggcg tcggcccgcg ggtctgcatc ggggcgcact tcgccctggt cgaagcgacg      1260
     ctggccctgg cgaaaatcgt cggcacgttc cggatcgagc tgatcgacag cgagccggtg      1320
     atcccgatcg gggtcgtcac cacccagccc gatcgctcgc ccccgttccg gctgacgcca      1380
     cgctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page