(data stored in ACNUC30630 zone)

EMBL: CP001096.PE425

CP001096.PE425       Location/Qualifiers
FT   CDS_pept        458213..458737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0427"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   nha:Nham_0044 protein of unknown function DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98987"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA1"
FT                   /protein_id="ACE98987.1"
FT                   /translation="MTMKYLMAVTAFAGAMICAATFAHAGKESPLSASGLPVPRYVSLK
FT                   SDHVNVRVGPTKDNDVAWVYTRAGLPVEVTAEFENWRRVRDSEGAEGWVYHSLLSGRRT
FT                   AVVTMKDKDGLAPLYESASSGSAVVARLQAGVVAQVKRCDMKWCRIVGSGFDGWIEKLQ
FT                   LWGVYADEQVN"
     atgacgatga aatacctgat ggcggtaacg gcgttcgcag gtgcgatgat ttgcgccgcg        60
     accttcgcgc acgccggcaa ggagtcaccg ttgtcggcga gcggactgcc ggtgccgcga       120
     tacgtcagtc ttaagtctga tcacgtcaat gtccgggtcg ggccgaccaa ggacaacgac       180
     gtcgcctggg tctacacccg cgccggcctg ccggtcgaag tcacggccga gttcgagaac       240
     tggcgccggg tccgggactc cgagggcgcc gaggggtggg tatatcactc gctcctgtcc       300
     ggtcgccgca ccgcggtcgt caccatgaag gacaaagacg gcttggcgcc gctgtatgag       360
     agcgccagct ccggcagcgc cgtggtggcc cggctgcagg ccggcgtggt ggcccaggtc       420
     aagcgctgcg acatgaaatg gtgccggatc gtcgggagtg gcttcgacgg ctggatcgag       480
     aagctgcagc tgtggggcgt ttacgccgac gagcaggtca actga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page