(data stored in ACNUC30630 zone)

EMBL: CP001096.PE43

CP001096.PE43        Location/Qualifiers
FT   CDS_pept        complement(47716..48828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0043"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: domain of unknown function DUF1730; KEGG:
FT                   bja:bll0714 iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98605"
FT                   /db_xref="GOA:B3Q5X6"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5X6"
FT                   /protein_id="ACE98605.1"
FT                   /translation="MKARLAEQARALGFDAFGICAPDSIPEAPARLRAFLDAGYHGEMA
FT                   WLADRPERRSDPRVMWSEVQSVILLGFNYGPDADPRAVLTQKDRGAISVYAQGDDYHDV
FT                   IKARLKQFARWLVATGGGDVKVFIDTAAVMEKPLAQAAGLGWQGRHTNLVSKGRGSWMF
FT                   LGAVFTTLDLPRDAAEGDHCGSCRACLDACPTAAFPAPYQLDARRCISYLTIEHKGPIP
FT                   REFRARLGNRIYGCDDCLAACPWNKFAQAGREAKLAARDALRAPALGELVRLDDPSFRA
FT                   LFTKSPVKRIGRDRFIRNALIAIGNSGDAELAPEAERLLADPSPTIRGAAAWALAQLLP
FT                   PERVATLKAVHLAAEVDDGVRAEWGGFAAE"
     ttgaaggcgc ggctcgccga acaggcacgc gctctcggct ttgatgcctt cggaatctgc        60
     gctcccgatt ccattcccga agcgccggcg cggctgcgcg cgtttctcga cgccggttat       120
     cacggcgaga tggcttggct cgccgatcgt cccgagcgtc gctccgatcc gcgtgtgatg       180
     tggagcgagg tccaaagcgt catcctgctc ggcttcaact atggcccgga cgccgatccg       240
     cgcgccgtgc tgactcagaa ggatcgcggt gccatctccg tctatgcgca gggcgacgat       300
     tatcacgacg tcatcaaggc ccggctgaag cagttcgcgc gctggctggt ggcgaccggc       360
     ggcggtgacg tgaaggtgtt catcgacact gcggcagtaa tggagaagcc gcttgcccag       420
     gccgccggtc tcggctggca gggccggcac accaatctgg tgtcgaaagg ccgcggctcc       480
     tggatgtttc tgggggctgt tttcaccacg ctcgatctgc cgcgggacgc agccgagggc       540
     gatcactgcg gctcgtgccg cgcctgcctc gacgcctgcc cgaccgccgc gtttccggcg       600
     ccgtaccagc tcgatgcccg gcgctgcatc tcgtatctga cgatcgagca caaaggcccg       660
     atcccgcggg agtttcgcgc gcgcctcggc aaccggattt acggctgtga cgattgtctt       720
     gccgcctgcc cgtggaacaa gtttgcccag gcggggcgcg aggcaaagct ggccgcgcgc       780
     gatgctctgc gggcaccggc gctcggcgaa ctggtgcggc tcgacgatcc gtcgtttcgg       840
     gccctgttca ccaagtcgcc ggtgaagcgt atcggccgcg accgcttcat ccgcaacgcg       900
     ctgatcgcga tcggcaattc cggcgacgcc gagctggcgc cggaggccga acggctgctc       960
     gccgatccga gcccgacgat ccgcggtgcc gcggcttggg cgctggcgca attgctgccg      1020
     ccggagcgcg tcgcgacact gaaggcggtg catctcgccg ccgaagtcga tgacggcgtg      1080
     cgggcggagt ggggcgggtt cgctgctgag tag                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page