(data stored in ACNUC30630 zone)

EMBL: CP001096.PE432

CP001096.PE432       Location/Qualifiers
FT   CDS_pept        465805..466743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0434"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: nwi:Nwi_0029 regulatory protein,
FT                   LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98994"
FT                   /db_xref="GOA:B3QAA8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA8"
FT                   /protein_id="ACE98994.1"
FT                   /translation="MISLRQLRYLSALARHGHFGRAADACSVTQPALSMQIAELERTLG
FT                   IKVVERRPGEVFLTDIGREIARRAEEVLAATRDLVDFARHRAKPLTGRLSLGVIPSLAP
FT                   YLLPKVLPLLQQHFPELRLELRESQTRPLVADVVSGVLDAALLALPVGHSDLDAIPLFD
FT                   DPFLLAVPADDPRAETTPIGVEEIDQSRLILLEDGHCLRDQALAFCATARNRGIQMGSA
FT                   GTASFGASSLTTVIQMVAGGYGITLIPQIAAEVERRDSRVKFLRLRRPQPGRSVGLVFR
FT                   KTSPRRGDFEAFGEVVKQGIGGAAPIESAVA"
     atgatctccc tgcgccagct tcgctatctg tctgccttgg ctcgacacgg ccatttcggc        60
     cgggcggccg atgcctgctc ggtgacccag ccggcgctgt cgatgcagat cgccgagttg       120
     gagcgaacgc tcggcatcaa agtggtggag cgccgaccgg gcgaggtgtt cctcacagac       180
     atcggccgcg agatcgcccg ccgcgccgaa gaggtgctgg cggcgacccg cgatctggtg       240
     gatttcgccc gccaccgggc taaaccgctg accgggcggc tcagtctcgg ggtgattccg       300
     tcgctggcgc cgtatctgct gccgaaggtg ctgccgctgt tgcagcaaca tttccctgag       360
     ctgcggctgg agctgcgcga aagccagacc cggccgctgg tcgccgacgt ggtcagtggc       420
     gtgctcgacg cggcgctgct ggccctgcct gtcggccatt cggatctcga cgcgatcccg       480
     ttgttcgatg atccgttcct gctcgcggtg ccggccgacg atccgcgcgc cgaaacgacg       540
     ccgatcggcg tcgaggagat cgaccagtcc cggctgatcc tgctggagga cggtcactgc       600
     ctgcgcgatc aggcgctggc gttctgcgcc accgcacgca atcgcggcat ccagatgggc       660
     agtgccggca cggcgagctt cggcgcctcc agcctcacca cggtgatcca gatggtcgcg       720
     ggcggttatg gcatcacgct gattccgcag atcgccgccg aggtcgagcg ccgtgattcg       780
     cgggtgaagt tcctgcggct gcgccggccg caaccgggcc gcagcgttgg cctcgtcttt       840
     cgcaagacct cgccccgccg tggtgacttc gaagcgttcg gcgaggtcgt gaaacagggg       900
     atcggcggcg cggcaccgat cgagtccgcg gtcgcctga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page