(data stored in ACNUC30630 zone)

EMBL: CP001096.PE433

CP001096.PE433       Location/Qualifiers
FT   CDS_pept        complement(466755..468437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0435"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: bbt:BBta_2308 putative methyl-accepting
FT                   chemotaxis receptor/sensory transducer with PAS domain;
FT                   TIGRFAM: PAS sensor protein; PFAM: chemotaxis sensory
FT                   transducer; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98995"
FT                   /db_xref="GOA:B3QAA9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAA9"
FT                   /protein_id="ACE98995.1"
FT                   /translation="MFSFTRSAGHDHAAAMLAALNRSQAVIEFDLDGNVIDANDNFLTA
FT                   LGYSLPEIKGKHHRMFVDPSEHDSTAYREFWTALRTGQYQAGEFHRIGKGGREVWIQAS
FT                   YNPILDKNGKPTGVVKFAADITAAKTQSLEDAGKLAAIGRAQAVIEFAMDGTVLTANDN
FT                   FLAAMEYSLGEIKGKHHSMFVEPSVRESSDYREFWARLNRGEYFPGEFKRIGKGGKEVW
FT                   ILASYNPILDARGKPFKVVKYATDVTAQKLKNADFSGQIDAIRKSQAVIEFSIDGTVLD
FT                   ANDNFLHALGYSLGEIKGRHHSIFIDPAERESAAYRAFWAALGRGDYQAGEYKRIGKGG
FT                   REVWIQASYNPILDLNGRPFKVVKYAADTTRQVLTRLGNERVRAMMESVAAGAEELNAS
FT                   VREISEAMTKSRQTAMNAVGEVDAADSQANQLNDAAQAMSGIVELINHITGQINLLALN
FT                   ATIESARAGEAGRGFAVVAAEVKNLANQAKQATDKIGTEISNLTSVSGDVVGALGKIKS
FT                   AIQNVSEYVSSTAAAVEEQSTVTSEMSSSMQRAAAEAAAIAAG"
     atgttctcct tcacccgctc tgccggccat gatcatgcgg cagcgatgct cgcggcgctc        60
     aatcgctccc aggcggtgat cgagtttgat ctggacggca acgtcatcga cgcaaacgac       120
     aactttctga ccgcgctcgg ctactcgctt ccagagatca agggcaagca tcaccggatg       180
     ttcgtcgatc cgagcgagca cgacagcaca gcctatcgcg agttctggac cgcgttgcgc       240
     accggccagt atcaagccgg cgaattccac cgcatcggca agggcggccg cgaggtctgg       300
     atccaggcgt cctacaaccc gatcctcgac aagaacggca aaccgaccgg cgtcgtgaag       360
     ttcgcggccg acatcaccgc ggccaagacc caatcgctgg aggatgccgg caagctcgcg       420
     gcaatcggcc gcgctcaggc ggtgatcgag tttgcgatgg acggcaccgt cctcaccgcc       480
     aacgataact ttctcgccgc gatggagtac tcgcttggcg agatcaaggg caagcatcac       540
     agcatgtttg tcgagccgtc ggtgcgcgag agcagcgact accgcgaatt ttgggcgcgg       600
     ctcaaccgcg gcgaatactt ccccggcgag ttcaagcgga tcggcaaggg cggcaaggag       660
     gtctggattc tggcgtccta caacccgatc ctcgacgcac gcggcaagcc gttcaaagtg       720
     gtgaaatacg ccaccgacgt caccgctcag aagctgaaga acgccgactt ctccggccag       780
     atcgatgcga tccgcaagtc acaggcggtg atcgaattca gcatcgacgg cacggtgctg       840
     gacgccaacg acaacttcct gcacgcgctg ggctactcgc tgggcgagat caagggccgg       900
     catcacagta ttttcatcga ccccgccgag cgcgagagcg cggcctatcg ggcattctgg       960
     gcggcgctcg gtcgcggcga ttatcaggcc ggcgaataca agcgcatcgg caaaggcggc      1020
     agggaagtct ggatccaggc ctcctacaac ccgatcctcg acctcaatgg gcggcctttc      1080
     aaggtggtga aatacgccgc cgacaccacc cgccaggtac tcacccggct cggcaacgag      1140
     cgcgtccgcg ccatgatgga atcggtcgcg gccggagcgg aggagctgaa cgcttcggta      1200
     cgcgagatct ccgaagcgat gaccaagtcg aggcagacag cgatgaacgc cgtcggcgaa      1260
     gtcgatgcag ccgactctca ggccaatcag ctcaacgacg cggctcaagc aatgagcggc      1320
     atcgtcgaac tgatcaacca catcaccggg cagatcaatc tgctggcgct caacgccacg      1380
     atcgagtcgg cgcgcgccgg cgaggccggg cgcggctttg ctgtggtggc ggcggaggtg      1440
     aagaacctcg ccaatcaggc caagcaggcc accgacaaga tcgggaccga gatcagcaat      1500
     ctcaccagcg tctccggcga cgtggtcggc gcgctcggca agatcaagag cgcgatccag      1560
     aacgtcagcg agtacgtcag ctcgacggct gcggcggtgg aggagcagag cacggtgacc      1620
     agcgagatgt cgtcgagcat gcagcgcgcc gccgcagaag cggccgcgat cgcagccggc      1680
     taa                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page