(data stored in ACNUC30630 zone)

EMBL: CP001096.PE438

CP001096.PE438       Location/Qualifiers
FT   CDS_pept        complement(473193..475844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0440"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Initiation factor 2 associated domain
FT                   protein; KEGG: bja:bll0783 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99000"
FT                   /db_xref="GOA:B3QAB4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB4"
FT                   /protein_id="ACE99000.1"
FT                   /translation="MVDTKTPGDKTLTMPTKTLTLKPRVEQGVVRQSFSHGRSKQVVVE
FT                   KRGKRRLGGDEPAAPAAPEVAKKPAPAPAAPPRQQQSRPAPQQSRSGMVLRTLTEDERT
FT                   ARATALADARVREIEERKQAEIEAQRRAEQEKIEKAEREAAEARRKAEEERHRQEDEAK
FT                   RKAETEAKKRFGDAEPAKKPAETSTTTTTAAPARPATTTTRAPTPAGRPPAVAAEAGDD
FT                   DEAPRMIRRPGGPARPAPPPKQPAAKPGASKQRGRLTVVTALNADDVRERSIASFRRRT
FT                   QRLKGHASNEPKEKLVREVVIPEVIAIQELANRMSERAVDVIRLLMKQGAMHKITDVID
FT                   ADTAQLIAEELGHTVKRVAASDVEEGLFDVVDDSTDTEPRSPVVTVMGHVDHGKTSLLD
FT                   ALRHANVVSGEAGGITQHIGAYQVTSPESGKKITFIDTPGHAAFTAMRARGAKVTDIVV
FT                   LVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPDAKPDRVRTDLLQHNVQVESMG
FT                   GDVVDVEVSAKNKINLDKLLEMIALQAEILELKTNTQRPAEGTVIEAKLDRGRGPVATV
FT                   LVQRGTLRVGDIIVAGAEMGRVRALISDQGETVQEAGPSVPVEVLGFNGPPEAGDRLAV
FT                   VENEARARQITDYRAHQKREKSAASVSGMRGSLEQMMTQLKTSGRKEFPLIVKADVQGS
FT                   LEAILGSLEKLGTDEVAARILHAGVGGISESDVTLAEGFNAVILGFSVRANKEAAAAAK
FT                   RNGIEIRYYNIIYDLVDDIKKAMSGLLAPTLRETMLGNAQILEIFNISKVGKVAGCRVT
FT                   DGTVERGANVRLIRDNVVVHEGKLSTLKRFKDEVKEVVAGQECGMAFENYTDMRAGDII
FT                   ECYRVETIQRSL"
     atggttgata cgaaaactcc tggcgacaag actctgacga tgccgaccaa gaccttgacg        60
     ctgaagcccc gcgtcgagca gggcgtcgtg cgccagagct tcagccacgg ccgtagcaag       120
     caggtggtgg tcgaaaaacg cggcaagcgg cgccttggtg gcgacgagcc ggccgcgccg       180
     gcggcgcctg aagtggcgaa gaagccggca ccggcacccg ccgcaccgcc ccggcagcag       240
     cagtcgcgcc ccgcgccgca gcagtcgcgt agcggtatgg tgctgcgcac cttgaccgag       300
     gacgagcgca ccgcccgcgc caccgcgctg gccgatgccc gcgtgcgcga gatcgaagag       360
     cgcaagcagg ccgagatcga agcgcagcgc cgcgccgagc aggaaaagat cgagaaggcc       420
     gagcgcgaag ccgccgaggc gcgccgcaag gccgaggaag agcgtcaccg ccaggaagac       480
     gaagccaagc ggaaggccga gactgaagcc aagaagcgct tcggcgacgc cgagccggcc       540
     aagaagccgg ccgagacctc gaccaccacc acgacggctg cgcctgcccg tccggcgacc       600
     acgacgacgc gcgctccgac tccggcaggc cgtccgccgg ccgttgcagc cgaagctggc       660
     gacgacgatg aagccccgcg gatgatccgc cgtccgggcg gccccgcccg tccggcgccg       720
     ccgccgaagc agccggccgc caagccgggc gcctcgaagc agcgcggccg tctcaccgtc       780
     gtcaccgcgc tcaatgccga tgacgtgcgc gaacgttcga tcgcctcgtt ccgtcgccgt       840
     acccagcggc tgaagggcca cgcctcgaac gagccgaaag aaaagttggt gcgtgaagtc       900
     gttattcccg aagtgatcgc catccaggaa ctcgccaacc gcatgtccga acgtgcggtc       960
     gacgtgatcc gcctgctgat gaagcagggc gcgatgcaca agatcaccga cgtgatcgac      1020
     gccgacaccg cgcagctgat cgccgaagag ctcggccaca ccgtcaagcg cgttgccgcg      1080
     tcggacgtag aagaaggtct gttcgacgtc gtcgacgatt ccaccgatac cgagccgcgt      1140
     tcgccggtcg tgaccgtgat gggccacgtc gaccacggta agacctcgct gctcgacgcg      1200
     ctgcgccacg ccaacgtggt gtcgggcgaa gccggcggca ttacccagca catcggtgcg      1260
     tatcaggtga cctcgccgga aagcggcaag aagatcacct tcatcgacac ccccggccac      1320
     gccgcgttca ccgcgatgcg cgcccgcggc gccaaggtga ccgacatcgt ggtgctggtg      1380
     gtcgccgccg acgacggcgt gatgccgcag accatcgagg cgatcaatca cgccaaggcg      1440
     gccggcgttc cgatcatcgt ggcgatcaac aagatcgaca agccggacgc caagcccgac      1500
     cgtgtccgca ccgacctgct gcagcacaat gtgcaggtgg aatcgatggg cggcgacgtc      1560
     gtcgacgtcg aggtttctgc caagaacaag atcaatctcg acaagctgct cgagatgatc      1620
     gcgctgcagg ccgaaatcct ggagctcaag accaacaccc agcgcccggc cgaaggcacc      1680
     gtgatcgaag ccaagctcga tcgcggccgt ggtccggtcg ccaccgtgct ggttcagcgc      1740
     ggcaccctgc gggttggcga catcatcgtg gctggcgccg agatgggccg cgtccgcgcg      1800
     ctgatctctg accagggcga gaccgtgcag gaagccggcc cgtcggtccc ggtcgaagtg      1860
     ctcggcttca acggtccgcc ggaagcgggc gaccgcctcg cggtggtcga gaacgaagcc      1920
     cgcgcccgcc agatcaccga ttaccgtgcg caccagaagc gcgagaagtc cgcagcctcg      1980
     gtttccggca tgcgcggctc gctcgagcag atgatgacgc agctgaagac gtccggccgg      2040
     aaggaattcc cgctcatcgt caaggcggac gtgcagggct cgctggaagc gatcctcggc      2100
     tcgctggaga agctcggcac cgacgaagtc gccgcgcgca tcctccacgc cggcgtcggc      2160
     ggcatcagcg agagcgacgt gacgctggcc gaaggcttca acgccgtgat cctcggcttc      2220
     tcggtccgtg ccaacaagga ggccgctgcg gccgccaagc gcaacggcat cgagatccgc      2280
     tactacaaca tcatctacga cctggtggat gacattaaga aggcgatgag cggcctgctc      2340
     gcgccgaccc tgcgcgaaac catgctgggc aacgcgcaga tcctggagat cttcaacatc      2400
     tccaaggtcg gcaaggtcgc cggctgccgc gtcaccgacg gtaccgtcga gcgcggcgcc      2460
     aatgtccgcc tgatccgcga caacgtcgtg gtgcacgaag gaaagctgtc gaccttgaag      2520
     cgcttcaagg acgaagtgaa ggaagtcgtc gccggccagg aatgcggcat ggcgttcgag      2580
     aactacaccg acatgcgggc aggcgacatc atcgagtgct accgcgtcga gaccatccag      2640
     cgctcgctgt aa                                                          2652
//

If you have problems or comments...

PBIL Back to PBIL home page