(data stored in ACNUC30630 zone)

EMBL: CP001096.PE442

CP001096.PE442       Location/Qualifiers
FT   CDS_pept        479406..480491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99004"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAB8"
FT                   /protein_id="ACE99004.1"
FT                   /translation="MPAATSLLPELDDIVRQGDPVRRADAVRRISDLYIRGAESFQPDH
FT                   VALFDGILLTLVPEIDVEVRSELAQRFSEITNAPPELVRQLVHDEDIGIAGPLLRRSTM
FT                   LDDPTLVELARLRGQTHLLAISERLSISPPITDVIVRRGDRDVVRKVAGNAGAEFSATG
FT                   FNGLIRRAAQDGVLAVAVGTRDDLSPPRLKDLLACSTDLVRRRLFESARPSARIAINRA
FT                   MRELAGESRQPSVQRDFDAAQRSVVELHNRGELNEATVIGFARAHQYEETVAALSAMTG
FT                   TRISTLDQMMSGERHDPVLILGKALGFGWATVRALIGLRLGPDRSVACPDVEEAQHNFE
FT                   RLALSTAQRVLGFWKMRQADA"
     atgcctgccg ctacatctct gcttcctgaa ctcgatgaca ttgtcaggca gggcgatccc        60
     gtccggcgcg ccgacgccgt gcgccggatt tccgacctgt atattcgggg cgctgagagc       120
     ttccagcccg atcatgtcgc gctgtttgat ggcatcctgc tgacgctggt gccggagatc       180
     gacgtcgaag ttcgcagcga actggcacag cggttttcgg aaatcaccaa tgcgccgccc       240
     gaactggtcc ggcagctcgt gcatgacgaa gacatcggta tcgccgggcc gctgttgcgg       300
     cgctcgacga tgctcgatga tccaacgctc gtcgaactcg ccaggctgcg tggtcagacg       360
     catctcctgg cgatctccga gcggctgagc atttcgccgc cgatcaccga cgtgatcgtg       420
     cgccggggtg accgcgatgt ggtgcgcaag gtcgccggca acgcgggcgc cgaattctcc       480
     gccaccggtt tcaacggcct gatccgccgt gccgcgcagg acggtgtgct ggcggtcgcg       540
     gttggcacgc gggacgatct gtcgccgccg cggctgaagg atctcttggc gtgctcgacc       600
     gatctggtgc gccggcgctt gttcgaaagt gcgcggccga gtgcgcggat cgcgatcaac       660
     cgggcgatgc gcgagctcgc tggcgagtcg cggcagccgt cggtgcagcg cgatttcgat       720
     gccgcacagc gctcggtggt ggagttgcac aacaggggtg aactcaacga agcgaccgtg       780
     atcggcttcg cgcgggcgca tcaatacgag gagaccgtgg cggcgctgtc ggcgatgacc       840
     ggcacgcgaa tctccaccct cgaccagatg atgtccggcg agcggcacga cccggtgctg       900
     atcctcggca aagcgctcgg cttcggctgg gcgaccgtac gagccctgat cgggctgcgg       960
     ctcgggccgg accgctcggt ggcctgcccc gacgtcgaag aagcgcagca caatttcgag      1020
     cgcctggcgc tgtccacggc gcagcgtgtg ctcggcttct ggaagatgcg acaggctgac      1080
     gcctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page