(data stored in ACNUC30630 zone)

EMBL: CP001096.PE447

CP001096.PE447       Location/Qualifiers
FT   CDS_pept        complement(484575..485720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0449"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: bja:bll0792 magnesium
FT                   and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99009"
FT                   /db_xref="GOA:B3QAC3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAC3"
FT                   /protein_id="ACE99009.1"
FT                   /translation="MPDGDRAENGSQASLQDSTRGQLPAVVHQGEVLHPHGGSWLIRAI
FT                   RSLFGWKPGSVRDDLQVVLDTSPPDDTGFSTLERTMLRNILGLHDRRIADVMVHRADIV
FT                   AIKQDIQLGELLSLFQDAAHSRLVVYNETLDDPVGIVHIRDLVAFMTAKAKVPPATVAK
FT                   RKKALPAGLDLRAIDLKMPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEY
FT                   GGTDGLVSIEDIVEQIVGEIDDEHDSTEPPSIVRQADGSFIADARASLEDVRAMIGDQF
FT                   VTGEAGEDVETLGGYLVNHVGRLPVRGEVIAGPGTFEFEVLDADPRRVKRLRIGPRKER
FT                   PAPRTRDSRRRETATDSAAPQTTDSGGSTSSPPAGDGTGSP"
     atgcccgacg gcgacagagc cgagaacggt tcgcaggcct cgctgcagga ctccacgcgc        60
     ggccagttac ccgcggtggt gcatcagggc gaagtgctgc atccgcatgg cggcagttgg       120
     ctgatccgtg cgatccgttc gctgttcggc tggaagcccg gctcggtgcg cgacgacctg       180
     caggtcgtgc tcgacaccag cccgcccgac gacaccggct tctcgacgct cgagcgcacg       240
     atgctgcgca acatcctcgg gctgcacgat cgccggatcg ccgacgtgat ggtgcatcgc       300
     gccgacatcg tcgcgatcaa gcaggacatc cagctcggcg aattgctcag cctgtttcag       360
     gacgcagcgc attcgcggct cgtggtttac aacgaaacgc tcgacgatcc ggtcggcatc       420
     gttcacatcc gcgacctcgt ggcgttcatg accgcaaagg cgaaggtgcc gccggcgacg       480
     gtcgccaagc gcaagaaggc gctgcccgcg ggcctcgatc tgcgcgcgat cgatctgaag       540
     atgccgctga ccgaaaccgg catcatccgc aagctgctgt atgtgccgcc gtcgatgcgg       600
     gcgatcgacc tgctggcgca gatgcaggcg gcgcgcatcc atctggcgct ggtggtcgac       660
     gaatacggcg gtactgatgg cctggtctcg atcgaagata tcgtcgaaca gatcgtcggc       720
     gagatcgatg atgaacacga ctcgaccgag ccgccgtcga tcgtgcgcca ggccgacggc       780
     tcgttcatcg ccgatgcgcg agccagtctg gaagacgtcc gcgccatgat cggcgatcag       840
     ttcgtcaccg gcgaagcggg cgaagacgtc gaaaccctcg gcggttacct cgtcaaccac       900
     gtcggccggc tgccggttcg cggcgaagtg atcgccggcc ccggcacctt cgaattcgaa       960
     gtgctcgacg ccgacccacg gcgggtgaag cggttgcgga tcggaccgcg caaggaacgc      1020
     cccgccccgc gcacacgcga cagccggcgg cgcgagaccg cgaccgattc cgccgcgccg      1080
     cagactactg acagcggcgg atccacctcc tctccacctg ccggcgacgg gaccggttcg      1140
     ccgtga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page