(data stored in ACNUC30630 zone)

EMBL: CP001096.PE459

CP001096.PE459       Location/Qualifiers
FT   CDS_pept        495903..496904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0461"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: nwi:Nwi_0218 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99021"
FT                   /db_xref="GOA:B3QAD5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAD5"
FT                   /protein_id="ACE99021.1"
FT                   /translation="MSSAQYDVLAIGNAIFDVLVRTEEDFLVKHGMAKGGMALIDEARA
FT                   AAIYADMGQATEMSGGSAANTIVGLASFGARTAYLGKVKDDQIGKLYTHDIRAAGVTFD
FT                   TKPATDGPATGCSYILVTPDGQRTMNTYLGAAQDLSPADIDEAKIAASAIIYLEGYLWD
FT                   PPQAKEAFLKASKIAHGAGRKVALTLSDAFCVDRYRGEFLELMRSKTVDLIFANEAELH
FT                   SLYQTSDFDAALNLLAQDVSLGVVTRSEKGCAVVDKDGVTLVPAAAIDQLVDTTGAGDL
FT                   FAAGFLFGLVRNLGYENAGRLGALAAAEVIQHIGARPQVSLKELAQQHGLAV"
     atgagctcag cccaatacga cgtcctcgcc atcggcaatg cgatcttcga cgtgctggtc        60
     cgcaccgaag aggactttct ggtcaagcac ggcatggcca agggcggcat ggcgctgatc       120
     gatgaagccc gcgccgcggc gatctatgcc gatatgggcc aggcgaccga aatgtccggc       180
     ggctcggccg ccaacaccat cgtcgggctg gcctcgttcg gtgcccgcac cgcctatctg       240
     ggcaaggtca aggacgacca gatcggcaag ctctacaccc acgacatccg cgccgcgggc       300
     gtcaccttcg acaccaagcc ggcgaccgac ggcccggcga ccggctgctc ctacatcctg       360
     gtgacgccgg acggccagcg cacgatgaac acctatctcg gcgctgcgca ggatctgtcg       420
     ccggccgata tcgacgaggc caagatcgcc gcctcggcca tcatctatct cgaaggctat       480
     ctgtgggatc cgccgcaggc caaggaagcg ttcctgaagg cctcgaagat cgcccatggc       540
     gccggtcgca aggtggcact gacgctgtcg gatgcgttct gcgtcgatcg ctatcgcggc       600
     gaattccttg agctgatgcg gtccaagacc gtcgacctga tcttcgccaa cgaggccgag       660
     ctgcactcgc tgtaccagac ctcggatttc gacgcggcgc tgaatctgct ggctcaggac       720
     gtctcgctcg gcgttgtcac ccggagcgag aagggctgcg cggtggtcga taaggatggc       780
     gtcaccctgg tgcctgccgc cgcgattgat cagctcgtcg acaccaccgg cgccggcgac       840
     ctgttcgcgg ccggcttcct gtttggtctg gtccgcaacc tcggctacga aaacgccggc       900
     cgcctcggcg cgctggctgc ggccgaagtg atccagcaca tcggtgcccg cccgcaggtg       960
     tcgttgaagg aactggcgca gcagcacggg ctggcggtgt ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page