(data stored in ACNUC30630 zone)

EMBL: CP001096.PE467

CP001096.PE467       Location/Qualifiers
FT   CDS_pept        complement(505663..506487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0469"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nha:Nham_0427
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99029"
FT                   /db_xref="GOA:B3QAE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE3"
FT                   /protein_id="ACE99029.1"
FT                   /translation="MSAQPTSRDETSPFGARAGLRVALPIIVLLAAIVAWDLIVRLNQI
FT                   PPYVLPGPLLVASTLMQDWPVLFGSLLTTLWTTLEGFVAAAVGGIALALLFNQSRLLEY
FT                   SLFPYAVVLQVTPVIAIAPLLLIYLPQETAVIVCAWIVAFFPVLSNTTLGLNSVDRNLA
FT                   GLFRLYGASRWQTLLRLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGSAGAGSGLAY
FT                   RIAESGYRLNIPRMFAALLLLSTAGIVIYLLLALISHLLLRRWHESALGKDN"
     atgagcgccc agcccacctc gcgtgacgaa acgtctccgt tcggcgctcg cgccgggctg        60
     cgcgtcgcgc tgccgatcat cgtcctgctc gccgcgatcg tcgcctggga cctgatcgtc       120
     aggctcaatc agatcccgcc ttatgtgctg ccgggaccat tgctggtcgc ttcgacgctg       180
     atgcaggact ggccggtgct gttcggctcg ctgctgacca cgctgtggac caccctggaa       240
     ggcttcgtcg ccgccgcggt cggcggcatc gcgctggcgc tgctgttcaa ccagtcgcgg       300
     ctgctcgaat attcgctgtt cccctatgcg gtggtgctgc aggtgacacc ggtgatcgcg       360
     atcgcgccgc tgctcttgat ctacctgccg caggaaaccg cggtgatcgt ctgcgcctgg       420
     atcgtcgcgt tctttccggt gctgtccaac accacgctgg ggctcaactc ggtcgaccgc       480
     aatctcgccg ggctgttccg gctttatggc gcctcgcgtt ggcagacgct gctccggctg       540
     aagctgccgg ccgcgctgcc ttacatcctc ggcggcttgc gcatcgccgg cggactgtcg       600
     ctgatcggcg ccgtggtggc ggagatcgct gcgggctcgg ccggcgccgg ctccggcctc       660
     gcctaccgga ttgccgaatc cggataccgg ctcaacattc cgcgcatgtt cgcagcattg       720
     ctgttgctgt cgacggcggg cattgtgatc tatctgctac tggcgctgat ttcgcatctg       780
     ctgctgcggc gctggcacga aagcgcgttg ggaaaggata attga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page