(data stored in ACNUC30630 zone)

EMBL: CP001096.PE469

CP001096.PE469       Location/Qualifiers
FT   CDS_pept        complement(507323..508465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0471"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   nha:Nham_0425 perplasmic binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99031"
FT                   /db_xref="GOA:B3QAE5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAE5"
FT                   /protein_id="ACE99031.1"
FT                   /translation="MSPAFLLRALTGVLLAVGVALASPVHASGHGHGAEKPAEKPPEPP
FT                   PPPRPKKPPPPKVQPVRKVPEGGFDKVSFGTNWVAEGEHGGFFQAVADGTYKTYGLDVS
FT                   IVPGGPNVNNRALLIAGKLDFFMTANTLQSFDAVANNVPVVAIAAMFQKDPQVFVSHPE
FT                   SKIETLNDLKPLTLFVSKEGITSYFQWLKSEYGFSEAKVKPYTFNPQPFIIDRRSAMQG
FT                   YVTSEPFTVEQAAKFKPSVLLLADYGLNGYSTLIETRRDLIDKNPDMIQRFVDASIIGW
FT                   YNYLYGDNSAGNAMIKQLNPEMTDEMLAYSVEKMKQYGIVDSGDAIKNGIGAMNDERYA
FT                   SFFDKMARAGVVTRGLDFRKAYTLQFINKGVGVDLRPKQK"
     atgagccccg ctttcctgct gcgagcgtta accggggtgc tgttggcggt gggggtggcg        60
     ctggcttccc ccgttcatgc ctccggccac ggccatggcg ctgaaaagcc cgccgaaaag       120
     ccgccggaac cgccgccccc gccccgaccg aagaagccgc cgccgccgaa ggtgcaaccg       180
     gtgcgcaaag tgcccgaagg gggcttcgac aaggtgtcgt tcggcaccaa ttgggtggcc       240
     gaaggtgagc atggcgggtt cttccaggcg gtcgcggacg gcacctacaa gacctacggc       300
     ctcgacgtca gcatcgtgcc gggcggcccg aacgtgaaca atcgcgcgct gctgatcgcc       360
     ggcaagctcg acttcttcat gaccgccaac acgctgcagt cgttcgacgc ggtggccaac       420
     aacgtgccgg tggtggcgat tgccgcgatg ttccagaaag acccgcaggt gttcgtctcg       480
     cacccggagt cgaagatcga gacgctgaac gatctgaagc cactgacgct gttcgtctct       540
     aaggagggca tcaccagcta cttccagtgg ctgaagtcgg aatacggctt cagcgaagcc       600
     aaggtgaagc cctacacctt caacccgcag ccgttcatta tcgatcgccg cagcgcgatg       660
     cagggctacg tcacctcgga gccgttcact gtcgaacaag ccgccaagtt caagccgagc       720
     gtgctgctgc tggccgacta cgggctgaac ggctactcga ccctgatcga gacccggcgt       780
     gatctgatcg acaagaaccc tgacatgatc cagcgcttcg tcgacgcgtc gatcatcggc       840
     tggtacaatt atctgtatgg cgataattcc gccggcaacg cgatgatcaa gcagctcaat       900
     ccggaaatga ccgacgagat gctcgcctat tcggtcgaga agatgaagca atacggcatc       960
     gtcgattccg gagacgccat caagaacggc atcggcgcga tgaacgacga acgctacgcc      1020
     tcgttcttcg acaaaatggc gcgtgccggg gtggtgacgc gcggcctcga tttccgcaaa      1080
     gcctatacgc tgcagttcat caacaagggc gttggcgtcg acctgcgtcc gaagcagaaa      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page