(data stored in ACNUC30630 zone)

EMBL: CP001096.PE489

CP001096.PE489       Location/Qualifiers
FT   CDS_pept        complement(530701..533982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0492"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: nha:Nham_0504
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99051"
FT                   /db_xref="GOA:B3QAG5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG5"
FT                   /protein_id="ACE99051.1"
FT                   /translation="MPNLYSEAFTADRVPGAGVTAVLGPTNTGKTHLAIERMVAHPSGL
FT                   IGLPLRLLAREVYNKIVDKVGANAVALVTGEEKIKPSKPRYWVSTVEAMPRDLDVSFLA
FT                   VDEIQIAADLERGHVFTDRILRRRGRDETLLLGAATMRPMIERLLPGASIVTRPRLSQL
FT                   EYAGDRKLTRQPRRTAIVAFSADEVYAIAELIKRQHGGAAVVLGSLSPRTRNAQVAMFQ
FT                   SGDVDYLIATDAIGMGLNLDVDHVAFASDRKFDGYQFRRLTPAEFAQIGGRAGRATRDG
FT                   TFGTTGRCAPFEPELVNALQNHSFEPVKMLQWRNAELDFASIGALQVSLAESPRHEALT
FT                   RAPVAEDLRVLDHVARDAEVREIAQGKAAVERLWDVCQVPDYRKIAPAAHAELVITLYR
FT                   FLMQKGRIPDSWFAAQVDQADRTDGGIDTLSARIAQIRTWTFVANRPDWLADPEHWQGI
FT                   SRDVENKLSDALHERLTERFVDRRTSVLMRRLRENTMLNTEIGKTGEVIVEGHVIGRLD
FT                   GFTFAPDAAEAGSDAKALQATAQKALAGEIDARAEKLSNAPDDQFILTSDGTIRWTGDA
FT                   VARLVGSDDVLRPRLRIIADDRLAGAPREAVQTRLDLWLKTHVEKILGPLFELGKAEDV
FT                   SGIARGIAFQLIESLGVLERAKIATEMKDLDQPSRATLRKYGVRFGAYHIYFPSLLKPA
FT                   ARALASLLWAQKQDNVDLAALSSAQHLAGSGRTSFPADKALDRDAYRTLGYRLCGERAV
FT                   RVDILERLADLIRPALAWREGASGEKPAGAFDGRSFVVTQAMTSLTGSAGEDFASILKA
FT                   LGYRMERRPAPPPAPKAAETASPATEEAAATSDMSAEDQAILAGAIAFEPSPTAEGDVA
FT                   EAAPTVDEQPAADEPAAVDQPVATAAEPAAEAAAAETAEQPAADASEAPASEVTTAEAS
FT                   SEAASAEAAPAAKAEPELVEVWRPGGRSDEHRPRHDRNRHRNRPQHGAPAGANESESAE
FT                   AKSDRGGGRRGKGEFRRDRRDQEGEGVRREASAEGRPPRERFKGRDKFQDKHQGGKGGR
FT                   DNQGGGSHRQVHSSAPRERDRPMDPNSPFAKLAALKEQLTAGRKD"
     atgcccaatc tgtactctga agcgtttact gctgaccgcg tccccggcgc cggtgtgacc        60
     gcggtgctgg gcccgaccaa caccggcaag acgcatctgg cgatcgagcg gatggtcgcg       120
     cacccatcgg gcctgatcgg ccttccgctg cggctgttgg cgcgcgaggt ctacaacaag       180
     atcgtcgaca aggtcggcgc caacgccgtc gcgctggtga ccggcgaaga gaagatcaaa       240
     ccctccaagc cgcgctactg ggtctcgacc gtcgaggcga tgccgcgcga tctcgacgtc       300
     tcgtttctgg ccgtcgacga aatccagatc gcggccgatc tcgagcgcgg ccacgtcttc       360
     accgatcgca tcctgcgccg gcgcggccgc gacgagacgc tgctgctcgg cgccgcgacg       420
     atgcggccga tgatcgagcg gctgctgcct ggcgccagca tcgtcacccg gccgcggctg       480
     tcgcagctcg aatatgccgg cgaccgcaag ctgacccggc agccgcgccg gaccgcgatc       540
     gtggcgttct cggccgacga ggtctatgcg atcgccgagc tgatcaagcg ccagcatggc       600
     ggcgctgcgg tggtgctcgg ctcgctgagc ccacgcaccc gcaacgccca ggtggcgatg       660
     tttcagtccg gcgacgtcga ttacctgatc gccaccgacg cgatcggcat ggggctcaac       720
     ctcgatgtcg accacgtcgc cttcgcgtcc gaccgcaaat tcgacggcta ccagtttcgc       780
     cgcctcaccc cggcggaatt cgcccagatc ggcggacgcg ccgggcgtgc cactcgggac       840
     ggcaccttcg gtaccaccgg gcgctgcgcg ccattcgagc ccgagctggt caacgccttg       900
     caaaatcaca gcttcgagcc ggtgaagatg ctgcagtggc gcaacgcgga gctggatttc       960
     gcctcgatcg gcgcactgca agtgtcgctc gccgagtcgc cgcggcacga agcgctgacc      1020
     cgcgcgccgg tcgccgagga tctccgcgtg ctcgaccatg ttgcccgcga cgccgaggtg      1080
     cgcgaaatcg cgcagggcaa agccgcagta gagcggctat gggatgtctg tcaggtcccg      1140
     gattaccgta agatcgcacc agcagcccat gccgagctgg tgatcacgct gtaccggttc      1200
     ttgatgcaaa aggggcggat accggatagc tggttcgctg cccaggtcga tcaggcggat      1260
     cgcaccgacg gcggcatcga cacgctttcc gcgagaattg cgcaaatccg cacctggacc      1320
     ttcgtcgcca accggccgga ttggctcgcc gaccccgaac actggcaggg catctcgcgc      1380
     gacgttgaaa ataaattgtc agatgcattg cacgaacggc tcacggaacg tttcgtcgat      1440
     cgccggacca gtgtattgat gcgccgcctg cgggaaaaca cgatgttgaa tacggaaatt      1500
     ggcaagactg gtgaggtgat cgtcgagggc cacgtgattg gccggctcga tggcttcacc      1560
     tttgcgcccg acgcggccga ggccggctcg gatgcgaagg cgttgcaggc gacagcgcaa      1620
     aaggcgctgg ccggcgaaat cgacgcgcgc gccgaaaagt tgtcgaacgc accggacgat      1680
     cagttcatcc tgacctccga cgggaccatt cgctggaccg gcgatgcggt cgcgcgactg      1740
     gtcggctcgg acgacgtgct gcggccacgg ctgcggatca tcgccgacga ccggctcgcc      1800
     ggcgccccgc gcgaagcggt gcagacccgt ctcgatctgt ggctcaagac ccatgtcgag      1860
     aagatcctcg ggccgctgtt cgaactcggc aaggccgaag atgtcagcgg cattgcccgc      1920
     ggcatcgctt tccagctgat cgagtcgctc ggcgtgctgg agcgcgccaa gatcgcgact      1980
     gagatgaagg atctggacca gccgtcgcgc gcgacattgc gcaaatacgg cgtgcggttc      2040
     ggcgcctatc acatctactt cccgtcgctg ctgaagccgg cggcgcgggc acttgcctcg      2100
     ctgctgtggg cgcagaagca ggacaatgtc gatctcgccg cgctgtccag cgcgcagcat      2160
     ctggccggca gcggccgcac ctcgtttccg gccgacaagg cgctcgatcg cgatgcgtat      2220
     cgcacgctcg gctaccggct gtgcggcgag cgcgccgtcc gcgtcgatat tctcgaacgt      2280
     ctggccgatc tgatccggcc cgcgctggcg tggcgcgaag gcgcgtccgg cgaaaagccg      2340
     gctggtgcct tcgacggccg gagcttcgtg gtcacccagg cgatgacctc gctgaccggt      2400
     tcggccggcg aagactttgc gtcgatcttg aaggcgctcg gctaccggat ggagcggcgc      2460
     ccggcaccgc cgcccgcgcc gaaggctgcc gagaccgctt cccccgctac ggaagaggct      2520
     gcagccacca gcgacatgtc ggccgaagac caggcgattc tggccggggc gattgcgttc      2580
     gaaccgtctc cgacagccga aggcgatgtt gccgaagctg cgccgaccgt tgacgagcag      2640
     cctgccgccg acgagcctgc tgctgtcgat cagcccgtag ctaccgcagc cgaaccggcc      2700
     gcagaggccg ccgccgccga aaccgcggag cagcctgccg ctgacgcgag cgaagccccc      2760
     gcgagcgaag tgacgacagc cgaagcctcg tccgaagctg ccagcgcaga agctgcgccg      2820
     gctgccaagg cggagccgga gctggtcgaa gtctggcgtc cgggtggccg ttccgacgag      2880
     catcggccgc gtcacgatcg taatcgccat cgcaatcgtc cgcagcacgg cgctcccgcc      2940
     ggtgcgaacg aaagcgagag cgccgaagcc aagagcgacc gcggtggcgg tcgccgcggc      3000
     aagggcgagt ttcgtcgcga tcgccgcgat caggaaggcg aaggcgtgcg ccgcgaggcc      3060
     tctgctgaag ggcgcccgcc gcgcgagcgc ttcaagggcc gcgacaaatt ccaggacaag      3120
     catcagggcg ggaagggcgg ccgcgacaat cagggcggcg gctcgcaccg gcaggtgcat      3180
     tccagcgccc cgcgcgagcg tgaccgaccg atggatccga attcgccgtt cgccaagctc      3240
     gccgcgctga aggagcaact caccgccggc cgcaaggact aa                         3282
//

If you have problems or comments...

PBIL Back to PBIL home page