(data stored in ACNUC30630 zone)

EMBL: CP001096.PE493

CP001096.PE493       Location/Qualifiers
FT   CDS_pept        complement(539349..540497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99055"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:B3QAG9"
FT                   /protein_id="ACE99055.1"
FT                   /translation="MNAPRGEAGKQSDHTATEDGRAAAAAQDFATTTRRHLLAGGLWLG
FT                   GAATLAGFVPTLALAQTKPVEADELTPPAPRSIEVRARPIDHFDLRDRAHRQFGALQFR
FT                   SGLILTSGFRGFGGLSALRLDPRGERFVAISDKATWFTGRIVYDGTALSGLADVEAAPL
FT                   LGPDGKPLRSRKWYDSESLAFDGGTAYVGFERVNQIVKFDFGRDGIRARGQPIAVPPAL
FT                   RKLPNNKGIESLVMVPKPHPLAGTLIALSERGLDAERNTIGFLIGGKSPGQFSVRRTEN
FT                   YDIADAALMHGGELLILERKFSWFEGVHIRIRRIALSTIVPGATVDGPSIFEADLGNEI
FT                   DNMEGLDVHIDAGGAIVLTMVSDDNFSMLQRTLLLQFTLEAD"
     atgaacgctc cgcggggcga ggctgggaag cagagcgacc acaccgcgac agaggacggt        60
     cgcgcggctg ctgccgcaca ggacttcgcc acgacgacgc gtcgccattt acttgcgggc       120
     ggcctgtggc ttggcggcgc cgccacgttg gccggtttcg tgccgaccct ggcgctggcg       180
     caaaccaaac cggtcgaagc cgacgagctg actccgccgg caccgcgttc gatcgaggtg       240
     cgggcccgcc cgatcgatca cttcgatctg cgcgaccgcg cccatcgcca gttcggtgcg       300
     ctgcagtttc gcagcggcct gatcctgacc tccggtttcc gcggcttcgg cgggctatcc       360
     gcgctgcggc tcgatccccg cggcgagcgg ttcgttgcga tcagcgacaa ggccacctgg       420
     ttcaccggcc gcatcgtcta tgacggaacg gcgctgagcg gtcttgccga cgtcgaggcg       480
     gcgccgctgc tcggccctga cggcaaaccg ctgcggtcac gtaagtggta cgacagcgag       540
     tcgctcgcat tcgacggcgg cacggcctat gtgggcttcg agcgggtcaa ccagatcgtc       600
     aaattcgact tcgggcgcga cggcatccgc gcgcgtggcc agccgatcgc ggtgcccccg       660
     gcgctgcgca agctaccgaa caacaagggc atcgaatcgc tggtgatggt gccgaagccg       720
     cacccgctgg ccggcacgct gatcgcgctg tccgagcgcg gcctcgatgc cgagcgcaac       780
     accatcggct tcctgattgg cggcaagtct cccgggcagt tctcggtccg ccgcactgag       840
     aactacgaca ttgccgacgc tgctctgatg catggcggcg agctgttgat cctggagcgc       900
     aagttctcct ggttcgaggg cgtgcacatc cgcatccggc ggattgcgct gagcacgatc       960
     gtgccgggcg cgaccgtgga cggcccgtcg atcttcgagg ccgacctcgg caacgagatc      1020
     gacaacatgg aagggctcga cgtccatatc gacgccggcg gcgcgatcgt gctgacgatg      1080
     gtgtcggacg acaatttctc gatgctgcag cgaaccctgc tgctgcaatt cacgctggaa      1140
     gccgactaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page