(data stored in ACNUC30630 zone)

EMBL: CP001096.PE5

CP001096.PE5         Location/Qualifiers
FT   CDS_pept        complement(7213..8331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0005"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: bja:bll0339 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98567"
FT                   /db_xref="GOA:B3QK03"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK03"
FT                   /protein_id="ACE98567.1"
FT                   /translation="MGPFPHDAQPATISADNPMGTDGFEFVEFAHPDPAQLHSLFKLMG
FT                   FSLVAKHRTKAISVYRQGDVNYLVNEQPGTHGTDFVTAHGPCAPSMAFRVVDAKQAYER
FT                   AISLGAEPAGVTAAEATLDVPAIKGIGGSLLYFVDRYGAKGSAYDAEFDWVGARDVRPA
FT                   GAGLYYIDHLTHNVHRGRMDVWTGFYAKLFNFRQIRFFDIEGRASGLFSRALTSPDGKI
FT                   RIPINEDAGDSGQIEEYLSLYRGEGIQHIACGCRDIYSTVEGLRAAGLPFMPSPPETYF
FT                   ERVDARLPEHGEDVARLQRNGILIDGEGVVDGGQTKVLLQIFSANAIGPIFFEFIQRKG
FT                   DDGFGEGNFKALFESIEEDQIRRGVLKAERAA"
     atgggaccat ttccgcacga tgcgcagccg gccacgatca gcgccgacaa tccgatgggc        60
     accgacggat tcgagtttgt cgaattcgct catccggatc cggcgcaact tcatagcctg       120
     ttcaagctga tgggcttcag cttggtcgca aagcatcgca ccaaggcgat ttcggtctat       180
     cgccagggcg acgtcaacta tctggtcaac gagcagcccg gcacccacgg caccgacttc       240
     gtcactgcac acggcccgtg cgcgccgtcg atggcgttcc gcgtggtcga tgccaagcag       300
     gcctacgagc gcgcgatctc gctcggcgcc gaaccggccg gcgtgacggc cgcggaggcg       360
     acactggacg taccagccat caagggcatc ggcggcagtc tgctgtattt cgtcgaccgc       420
     tacggtgcca aggggtcggc ctacgatgct gaattcgact gggtcggtgc ccgcgacgtt       480
     cggcccgccg gcgccgggct ctattacatc gatcatctga ctcacaacgt ccatcgcggc       540
     cgtatggatg tctggaccgg gttctatgcc aaactgttca acttccggca gatacgcttc       600
     ttcgacatcg aaggtcgcgc ctccggcctg ttctcgcgtg cgctgaccag cccggacggc       660
     aagattcgga ttccgatcaa cgaggacgcc ggtgattcag gccagatcga agagtatctc       720
     agcctgtatc gcggcgaggg catccagcat atcgcctgcg gctgccgcga catctacagc       780
     acggtcgaag gacttcgtgc cgccggcctg ccattcatgc cgtcgccgcc ggagacgtat       840
     ttcgaacgcg tcgatgcacg tctgccggag catggtgagg acgtcgcccg gctgcagcgg       900
     aacggcatcc tgatcgacgg tgaaggcgtc gtcgacggcg gtcagaccaa ggtgctactg       960
     cagatcttct cggcgaatgc gatcggcccg atcttcttcg aattcatcca gcgcaagggc      1020
     gacgacggct tcggcgaagg caacttcaag gcgctattcg agtcgatcga agaagaccag      1080
     atccgccgag gcgtgctgaa agcggagcgt gcggcgtag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page