(data stored in ACNUC30630 zone)

EMBL: CP001096.PE524

CP001096.PE524       Location/Qualifiers
FT   CDS_pept        575857..576039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0527"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: bra:BRADO0557 50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99086"
FT                   /db_xref="GOA:B3QBD3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3QBD3"
FT                   /protein_id="ACE99086.1"
FT                   /translation="MAVPRRKTSPSRRGMRRSADAIKRPTYVEDKDSGELRRPHHLDLK
FT                   TGMYKGRQVLKKKDS"
     atggccgttc cgagaagaaa aacttcgccc tcgcggcgtg gcatgcgccg gtccgcggac        60
     gcgatcaagc gcccgaccta tgtcgaggac aaggattccg gcgagctgcg ccgcccgcac       120
     catctcgatc tcaagaccgg gatgtacaag ggccgccagg ttctgaagaa gaaggattcc       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page