(data stored in ACNUC30630 zone)

EMBL: CP001096.PE54

CP001096.PE54        Location/Qualifiers
FT   CDS_pept        58136..58597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0054"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bra:BRADO0111
FT                   nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98616"
FT                   /db_xref="GOA:B3Q5Y7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5Y7"
FT                   /protein_id="ACE98616.1"
FT                   /translation="MTITDLVAPEAVIPALKVISKKQALQELAARAAELTGQNERTIFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLEKLFGLFARLERPIDFEAMDGQPVDLIFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDAHAIYSVLALPPATAA"
     atgacgatta cggatcttgt cgcgcccgag gccgtcatcc cggcgctgaa ggtgatcagc        60
     aagaagcagg cgctgcagga actcgcggcg cgtgcagcgg agctgaccgg ccagaacgag       120
     cgcacgatct tcgaagtgct gctgcagcgc gagaagctgg gcaccaccgc ggtcggctat       180
     ggggtggcga ttccgcacgg caagctgccg aagctggaga agctgttcgg gctgttcgcg       240
     cggctggaac ggccgatcga tttcgaagcg atggacgggc agccggtcga cctgatcttc       300
     ctgctgctgg cgcccgaagg tgccggcgcc gaccacctca aggcgctggc gcggatcgcc       360
     cgcctgctgc gcgaccagga cgtcgccaag aagctgcgcg cttcccgcga cgcgcacgcg       420
     atctactcgg tgttggcgct gcctcccgcg actgcggcgt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page