(data stored in ACNUC30630 zone)

EMBL: CP001096.PE540

CP001096.PE540       Location/Qualifiers
FT   CDS_pept        complement(594742..595794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0543"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: bja:bll1341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99102"
FT                   /db_xref="GOA:B3QBE9"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBE9"
FT                   /protein_id="ACE99102.1"
FT                   /translation="MTLRSKTLQVIETIAIGSAGGALFYWAQLPGGLITGAMIAVGAAG
FT                   LAGRKMGLPPPLSHIVLMALGVSLGSVVSPTMVHNLASYPVTIGLLAVATFCATFGSSI
FT                   YLQRVHGWDRTSALLAGSPGALSQIIMLATERKADVPGIAVVQVMRVIILTSAVPMLLA
FT                   LIGMAGHGALPSRGPEATPLVLAVLIAVAVGVALLLRLVNFPASWMFGAMLGSSVLHGG
FT                   GWVEGTLPQWAYLAALVGIGTLIGARFGAIKPRTILSYIGAALGSFAVAIAISAVFVIA
FT                   IMLTTPVKLNDLVVAFSPGAMDAMMALALTLHIDPVFVGAHHLSRFIYVSIVTPGIVHL
FT                   FGHSPDDVDD"
     atgacattgc ggtccaagac tctccaggtg atcgaaacga tcgccatcgg ctctgccggc        60
     ggcgcattgt tctattgggc ccagctcccc ggcggactga tcacgggcgc gatgatcgcg       120
     gtcggcgccg ccggccttgc cggacgcaag atgggcctgc cgccgccgct gtcgcatatc       180
     gtgctgatgg cgctcggcgt ctcgctgggc tcggtggtgt cgcccaccat ggtgcacaat       240
     ctagcgtcct atccggtgac gatcgggctg ctcgcggtgg cgacgttctg cgccaccttc       300
     ggcagcagca tctatctgca gcgcgtccat ggctgggacc ggacgtcggc attgctggcc       360
     ggcagtcccg gcgcgctgtc gcagatcatc atgctggcca ccgaacgcaa agcggatgtg       420
     cccggcatcg ccgtcgttca agtcatgcgt gtgatcatcc tgaccagcgc agtaccgatg       480
     ctgctggcgc tgatcggcat ggcgggtcac ggggcgctgc cgtcccgcgg accggaggcg       540
     acaccgctcg tcctggcggt cctgatcgct gtcgcggtcg gtgtcgcgct gctgctgcgg       600
     ctggtgaact tcccggcaag ctggatgttc ggtgcgatgc tcggctcgtc ggtgctgcac       660
     ggcggcggtt gggtggaagg cacgctgccg caatgggcct acctcgccgc actggtcgga       720
     atcggcaccc tgatcggcgc tcggttcggc gccatcaagc cgcgcaccat cctgagctat       780
     atcggagcgg cactcggctc gttcgcggtc gcaatcgcga tctcggcggt gttcgtcatc       840
     gccatcatgc tgaccacgcc ggtcaagttg aacgacctgg tggtggcgtt ttcacccggt       900
     gcgatggacg ccatgatggc gctggcgctg accctgcaca tcgatccggt gtttgtcggc       960
     gcgcaccatc tgtcgcgctt catctacgtc tcgatcgtga cgccagggat cgtgcatttg      1020
     ttcgggcaca gcccggacga cgtcgacgac tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page