(data stored in ACNUC30630 zone)

EMBL: CP001096.PE541

CP001096.PE541       Location/Qualifiers
FT   CDS_pept        595989..596516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0544"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: bra:BRADO6543 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99103"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF0"
FT                   /protein_id="ACE99103.1"
FT                   /translation="MRVLRYETRAALLTAAALLTWSAATPAQALTAQECSAKYQAAKTD
FT                   GTLNGQGWNDFRKEHCGAAASTDSKAAEAKPADAKPDAKREAKSEAKPADSKPESKSKA
FT                   KSAAVPSVPQGPAVYPSAIDAKFAQEKPTLARLHTCAQQWKANKAANTTGGLRWIQKGG
FT                   GYWSECNKRLKG"
     atgagagttc tgaggtacga gacccgtgcg gcgctgctga cggcggcggc gctgctgaca        60
     tggtcggcgg caacgcccgc gcaggcgctg actgcgcagg agtgcagtgc caagtatcag       120
     gccgcaaaga ccgacggcac actgaacggg cagggctgga acgacttccg taaagagcat       180
     tgcggggcag ccgcgagcac cgacagtaag gcggcggaag ccaagccggc agatgcgaag       240
     cctgacgcga agcgggaagc caaatctgaa gccaagcctg ccgactcgaa acccgagagc       300
     aagtcgaaag caaagagcgc cgcagtgccg tctgtgccgc aggggcctgc ggtgtatcca       360
     agtgcgatcg acgccaagtt cgcccaggaa aagccgacgc tggcgcggct gcatacctgc       420
     gcgcagcagt ggaaggccaa taaggccgcc aacacaacgg gcggcctgcg ttggatccag       480
     aagggcggcg gctactggag cgagtgcaac aagcgcctaa agggctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page