(data stored in ACNUC30630 zone)

EMBL: CP001096.PE546

CP001096.PE546       Location/Qualifiers
FT   CDS_pept        599594..600748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0549"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bbt:BBta_2998 putative membrane protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99108"
FT                   /db_xref="GOA:B3QBF5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBF5"
FT                   /protein_id="ACE99108.1"
FT                   /translation="MPASENKFFILLLVVATGLFGWILWPLYSAVLWGMVIAILFAPLN
FT                   RGLNRAFGFRRNLAALMSVTIIVLMVLLPMSLLGAALAREAAGMYTKIESGNLDLLKTM
FT                   RELLAARPDWLGDLLSRFGVGNLADIQQRLSAALLRGSQYLAGQALDIGQSTFDFTVNL
FT                   FVMVYLLFFLLRDGDLLAARIRRATPLGVDHQTRLLDKFTVVIRATVKGNMLIALIQGA
FT                   LGGLAFYVLGISGALMWAVVMAFLSLLPAVGAGIVWLPMALYLIASGSVWHGVGLIVWG
FT                   MLVIGMVDNFLRPILVGKDTRMPDYVVLISTLGGLEVFGLNGFVIGPVIAAMFIATWDI
FT                   YSIAREDAGDTPRIGAGTGPAAVAPSEPSGPVPVRSDSGTTPVA"
     atgccggcat ccgaaaacaa gttcttcatt cttctgctgg tggtcgccac cggtctgttc        60
     ggttggatcc tgtggccgct gtacagcgcg gtgctgtggg gcatggtgat cgcgattctg       120
     ttcgcgccgc tgaaccgggg cctcaaccgc gccttcggct tccggcgcaa ccttgcggct       180
     ctgatgtcgg tgacgatcat cgtgctgatg gtgctgctgc cgatgtcgct gctcggtgca       240
     gcgttggcca gggaagcggc cggcatgtac accaagatcg agtccggcaa cctcgatctg       300
     ctgaaaacca tgcgggagct gttggcggcc cggccggatt ggctcggcga tctgctcagc       360
     cgcttcggcg tcggcaatct cgcggacatc cagcaacggc tgtcggctgc gctgttgcgc       420
     ggcagccagt atctggccgg gcaggcgctc gatatcgggc agagcacctt cgacttcacc       480
     gtcaatctgt tcgtgatggt gtatctgctg ttcttcctgc tgcgcgacgg agatcttctg       540
     gcggcgcgga tccggcgtgc gacgccgctc ggcgtcgatc atcagacccg tttgctggac       600
     aagttcaccg tggtgatccg cgccaccgtg aagggcaaca tgctgatcgc cctgatccag       660
     ggcgcgctcg gcgggctcgc cttctacgtg ctcggcatca gtggcgcgct gatgtgggcg       720
     gtggtgatgg cgtttctgtc gctgctgcca gcggtcggcg ccggcatcgt ctggctgccg       780
     atggcgctgt atctgatcgc gtccggctcg gtctggcatg gcgtcgggtt gattgtgtgg       840
     ggcatgctgg tgatcggcat ggtcgacaat ttcctgcgcc cgatcctggt cggcaaggac       900
     acacggatgc cggattacgt cgtgctgatc tccaccctcg gcgggctgga agtgttcggc       960
     ctgaacggct tcgtcatcgg cccggtgatc gccgcgatgt tcatcgccac ctgggacatc      1020
     tattctatcg cgcgcgagga tgcgggcgac acgccccgga tcggcgccgg caccgggccg      1080
     gccgcggtcg cgccctccga gcccagcgga cccgtgccgg tccgcagcga tagcgggacg      1140
     acgcctgtcg cctag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page