(data stored in ACNUC30630 zone)

EMBL: CP001096.PE562

CP001096.PE562       Location/Qualifiers
FT   CDS_pept        614846..615958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99124"
FT                   /db_xref="GOA:B3QBH1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH1"
FT                   /protein_id="ACE99124.1"
FT                   /translation="MTSSRTRLLSQWKPRRPQWGLALRITLAALLALGFAQSLHLHLPL
FT                   WAVLTAIIVTQTSVGRSLKTAGDYLIGTIGGAIYGGAITIFVPHHSELGLLGALALAVA
FT                   PLALLAAIKPNLNVATVTAIIVLLVPTITKVEPLASAIDRVLEVGVGAIVGLAVSFVVL
FT                   PSRAQGQALAAAARSLELMADALGALLAGLTKGLDNDALHRLQDGIGASLVTLAEIGAE
FT                   AQRERNAGLSRGPDVAPLVRTLLRLRHDLVIVGRAVTAPLPPSLQNRLGGAVDNLRLAA
FT                   TSHLSACAKALRERRAPPPLGPMEQALAAYVTEVAAVRRDGLIRALPGDQAERFFALGF
FT                   AMEQLHQNFRDLEMRVTEWALPGKPTARVA"
     atgacatcct ccaggacacg cctgctttcg caatggaaac cgcgccggcc ccaatggggc        60
     ctggcgctgc gtatcactct cgcggcgctg cttgcgctgg ggttcgcgca aagcctgcat       120
     ttgcatctgc cgctgtgggc cgtgctcacc gcgatcatcg tgacgcagac cagcgtcggt       180
     cggtcgctga aaacggcggg cgattatctc atcggcacca tcggcggcgc gatctatggc       240
     ggcgccatca cgatctttgt gccgcatcac agcgagctcg ggctgctcgg agccctggcg       300
     ctggcggtgg cgccgttggc gctgcttgcg gccatcaagc ctaacctcaa cgtcgccacg       360
     gttacggcga tcatcgtgct gctggtgccg accatcacca aggtcgagcc gctggcctcg       420
     gcgatcgacc gcgtgctcga agtcggggtc ggggcaatcg tggggctcgc ggtatcgttc       480
     gtggtgctgc cgtcgcgggc gcaggggcag gcgctcgccg cggcggcgcg ctcgctcgaa       540
     ctgatggccg atgcactcgg cgccctgctg gcgggcctga caaagggcct cgacaacgat       600
     gcgctgcacc ggctgcagga cggcatcggg gcgtcgctgg tgacgctcgc ggaaatcggc       660
     gccgaggcac agcgcgagcg caacgccggg ctgtcacgtg ggccggacgt cgcgcctctc       720
     gtccgcacgc tgctccgcct gcgccacgat ctggtgatcg tgggccgggc cgtcaccgcc       780
     ccgctgccgc cgtcgctgca gaaccggctg ggcggcgcgg tcgacaacct gcgccttgcc       840
     gcgacctcgc atctgtcggc ctgcgccaaa gcgctgcgcg agcgccgcgc gccgccgccg       900
     ctcgggccga tggaacaggc gctggctgct tacgtcacgg aagtcgcagc ggtccggcgg       960
     gacggcttga ttcgggcact cccaggcgat caggccgagc ggttcttcgc gctcggcttt      1020
     gcgatggagc aactgcacca gaacttccgt gacctcgaaa tgcgggtcac cgaatgggcg      1080
     ctgccgggca agccgaccgc gcgggtcgcg tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page