(data stored in ACNUC30630 zone)

EMBL: CP001096.PE563

CP001096.PE563       Location/Qualifiers
FT   CDS_pept        complement(615963..616424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99125"
FT                   /db_xref="GOA:B3QBH2"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH2"
FT                   /protein_id="ACE99125.1"
FT                   /translation="MYDVFKFLHVVGVVVLVGNVTITAFWKAFSDMTRDPKIVAHAQRG
FT                   VTVSDFIFTLTGIALIIIGGYGAALVKDMPLFNSFWLVAGQILFVISGLMWFGILIPLQ
FT                   IRQARTARSFAEGGEIPAQYWRDAKTWLIWGITATVPLVAAVFVMIYKI"
     atgtatgatg ttttcaagtt tctccacgtc gtcggcgtgg tcgttctggt cggcaacgtc        60
     accatcaccg ccttctggaa agcgttctcc gacatgaccc gcgatccgaa gatcgtcgcg       120
     cacgcgcagc gcggcgtcac ggtgtcggat ttcatcttca cgctgaccgg catcgccctg       180
     atcatcatcg gcggctacgg cgccgcgctg gtcaaggaca tgccgctgtt caactcgttc       240
     tggctggtgg ccgggcagat ccttttcgtg atctccggcc tgatgtggtt cggcatcctg       300
     atcccgctac agatccggca ggcacgcacg gcgcgcagct tcgccgaggg cggcgagatc       360
     ccggcgcagt attggcgcga cgccaagacc tggctgatct ggggcatcac cgcgaccgtg       420
     cccctggtcg cggccgtgtt cgtgatgatt tacaaaatct aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page