(data stored in ACNUC30630 zone)

EMBL: CP001096.PE568

CP001096.PE568       Location/Qualifiers
FT   CDS_pept        complement(620277..620942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0571"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_7673 putative enzyme with
FT                   metallo-hydrolase/oxidoreductase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACE99130"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B3QBH7"
FT                   /protein_id="ACE99130.1"
FT                   /translation="MSETQTKAKAGAAIIPVTPFQQNCTLLWCEATRKAVVVDPGGDVP
FT                   EILAAIEKTKVDVGAIWLTHGHIDHVGGAADLRDALKVEVIGPHRDDQFLLDNVVNSGR
FT                   SFGIDGVRDVTPDRWLDDGDSVSIGELNFQILHCPGHSPGSVVFFNDAMRFAFVGDVLF
FT                   AGSVGRTDLPGGSHATLIQSITQKLLPLGDDVGFICGHGPGSSFGQERLTNPFLTGEA"
     atgagcgaga cccagaccaa ggccaaagcc ggcgccgcga tcattcccgt gacgccgttt        60
     cagcagaact gcacgctgtt gtggtgcgaa gccacccgca aggctgtggt ggtcgatccc       120
     ggcggcgacg tgcccgagat cctggccgcg atcgaaaaaa ccaaagtcga cgtcggggcg       180
     atctggctca cccatggcca catcgaccat gtcggcggcg cggccgatct gcgcgacgcg       240
     cttaaggtcg aggtgatcgg cccgcatcgc gacgaccagt tcctgctcga caacgtcgtc       300
     aactccggcc gcagcttcgg gatcgacggc gtccgcgacg tcaccccgga ccgctggctc       360
     gacgacggtg acagcgtcag catcggcgag ctgaattttc agatcctgca ctgccccggc       420
     cattcgccgg gcagcgtcgt gttcttcaac gatgcgatgc ggttcgcctt cgtcggcgac       480
     gtgctgtttg ccggctcggt cggccgtacc gatctgccgg gcggcagcca cgccaccctg       540
     attcagtcga tcacccagaa gctgctgccg ctcggcgacg acgtcggctt catctgcggt       600
     cacggccccg gctccagctt cggtcaggag cgcctgacca acccgttcct gaccggcgaa       660
     gcctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page