(data stored in ACNUC30630 zone)

EMBL: CP001096.PE6

CP001096.PE6         Location/Qualifiers
FT   CDS_pept        8457..8936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0006"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bja:blr0340 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98568"
FT                   /db_xref="GOA:B3QK04"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK04"
FT                   /protein_id="ACE98568.1"
FT                   /translation="MMSVDAFDLKILSALQDDGRLTNQELADRVQLSPSQCSRRRMRLE
FT                   QDNIITGYRAELSGDALGFGVVAFIQITLATHSPDNAEKFRSLIGRIDEVQEAYSLTGD
FT                   ADYVLKAVLRDLKGLSELVNNVLMPHQSVAHVRSSIVLDRLKESTRLPLKQPANG"
     atgatgtctg tcgatgcgtt cgacctgaag atcctgagcg cactgcagga cgacggccgg        60
     ctcaccaacc aggagctggc cgaccgggtg cagctgtcgc cctcgcaatg ctcccggcga       120
     cggatgcggt tggagcagga caacatcatc accggctatc gcgccgagct gtccggcgac       180
     gcgctcggct ttggcgtggt cgccttcatc cagatcaccc tggcgacaca ttcgccggac       240
     aacgccgaga agttccggtc gctgatcgga cggatcgacg aggtgcagga agcctattcg       300
     ttgaccggcg acgccgacta cgtgctcaag gccgtgctgc gcgacctgaa ggggctctcc       360
     gagctggtga acaacgtact gatgccgcac cagagcgtcg cgcatgtccg ctcatcgatc       420
     gtactggatc gcctcaagga aagcacacgg ctgccgctga agcagcccgc aaacggctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page